close

SimulationCraft 725-01

for World of Warcraft 7.2.5 Live (wow build level 24287, git build f220cdb)

Current simulator hotfixes

Death Knight

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-01-10 Portal to the Underworld damage increased by 33%.
Dragged to Helheim (effect#1) ap_coefficient 1.60 1.20

Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-1-8 Spelldata claims that Marking Target's rppm was buffed from 5 to 6.5, but testing shows higher.
Hunter's Mark rppm 7.20 6.50

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00
2017-01-11 Incorrect spell level for Frozen Orb Bolt.
Frozen Orb spell_level 57.00 81.00

Mark of the Distant Army

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-01-10 Set Velocity to a reasonable value.
Mark of the Distant Army prj_speed 40.00 1.00

Table of Contents

Raid Summary

 

Actions per Minute / DPS Variance Summary

T19 2pc : 1310539 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1310538.6 1310538.6 2887.8 / 0.220% 285684.7 / 21.8% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.51% 60.6 100.0% 100%
Talents
  • 15: Landslide (Enhancement Shaman)
  • 30: Rainfall (Enhancement Shaman)
  • 45: Voodoo Totem
  • 60: Hailstorm (Enhancement Shaman)
  • 75: Tempest (Enhancement Shaman)
  • 90: Crashing Storm (Enhancement Shaman)
  • 100: Ascendance (Enhancement Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
T19 2pc 1310539
Crash Lightning 8586 (13787) 0.7% (1.1%) 11.6 25.04sec 359372 341234 Direct 11.6 189217 378462 223765 18.3% 0.0%  

Stats details: crash_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.64 11.64 0.00 0.00 1.0532 0.0000 2604469.26 2604469.26 0.00 341234.16 341234.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.51 81.73% 189217.09 179239 202409 189510.33 181928 202409 1799942 1799942 0.00
crit 2.13 18.27% 378461.99 358479 404819 327064.15 0 404819 804527 804527 0.00
 
 

Action details: crash_lightning

Static Values
  • id:187874
  • school:nature
  • resource:maelstrom
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:artifact.alpha_wolf.rank&prev_gcd.1.feral_spirit
Spelldata
  • id:187874
  • name:Crash Lightning
  • school:nature
  • tooltip:Stormstrike and Lava Lash deal an additional $195592sw1 damage to all targets in front of you.
  • description:Electrocutes all enemies in front of you, dealing $sw1 Nature damage. Hitting 2 or more targets enhances your weapons for {$187878d=10 seconds}, causing Stormstrike and Lava Lash to also deal $195592sw1 Nature damage to all targets in front of you.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.50
 
    Crashing Storm 5201 0.4% 80.7 3.40sec 19553 0 Direct 80.7 16497 32983 19552 18.5% 0.0%  

Stats details: crashing_storm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.71 80.71 0.00 0.00 0.0000 0.0000 1578037.80 1578037.80 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.75 81.46% 16496.51 14519 18094 16522.92 15766 18035 1084575 1084575 0.00
crit 14.96 18.54% 32983.03 29037 36187 33034.00 0 36187 493462 493462 0.00
 
 

Action details: crashing_storm

Static Values
  • id:210801
  • school:nature
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210801
  • name:Crashing Storm
  • school:nature
  • tooltip:
  • description:{$@spelldesc192246=Crash Lightning also electrifies the ground, leaving an electrical field behind which damages enemies within it for ${7*{$210801s1=1}} Nature damage over {$210797d=6 seconds}. }
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.160000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Dread Torrent 39296 3.0% 53.0 10.59sec 222847 0 Direct 53.0 187694 375382 222864 18.7% 0.0%  

Stats details: dread_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.96 52.96 0.00 0.00 0.0000 0.0000 11801899.19 11801899.19 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.04 81.27% 187694.33 182405 187918 187689.09 186828 187918 8078449 8078449 0.00
crit 9.92 18.73% 375382.04 364809 375836 375377.60 371425 375836 3723450 3723450 0.00
 
 

Action details: dread_torrent

Static Values
  • id:246464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246464
  • name:Dread Torrent
  • school:shadow
  • tooltip:
  • description:{$@spelldesc246461=Create a Dread Reflection at your location for {$d=60 seconds} and cause each of your Dread Reflections to unleash a torrent of magic that deals ${{$246464s1=39731 to 43913}*4} Shadow damage over {$246463d=3 seconds}, split evenly among nearby enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:140074.50
  • base_dd_max:154819.18
 
Flametongue 15097 (65934) 1.2% (5.0%) 19.9 15.42sec 993081 936424 Direct 19.9 192229 384191 228192 18.7% 0.0%  

Stats details: flametongue

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.88 19.88 0.00 0.00 1.0606 0.0000 4535626.86 4535626.86 0.00 936423.51 936423.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.15 81.26% 192229.10 179999 210826 192316.10 185724 204166 3104690 3104690 0.00
crit 3.72 18.74% 384191.12 359999 421651 377049.22 0 421651 1430937 1430937 0.00
 
 

Action details: flametongue

Static Values
  • id:193796
  • school:fire
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!buff.flametongue.up
Spelldata
  • id:193796
  • name:Flametongue
  • school:fire
  • tooltip:
  • description:Scorches your target, dealing {$s2=1} Fire damage, and enhances your weapons with fire for {$194084d=16 seconds}, causing each weapon attack to deal up to ${$<coeff>*$AP} Fire damage, based on weapon speed.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Flametongue Attack 50837 3.9% 903.3 0.60sec 16829 0 Direct 903.3 14188 28380 16829 18.6% 0.0%  

Stats details: flametongue_attack

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 903.34 903.34 0.00 0.00 0.0000 0.0000 15202307.89 15202307.89 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 735.22 81.39% 14187.56 12111 15550 14193.05 13861 14635 10431132 10431132 0.00
crit 168.12 18.61% 28379.87 24223 31099 28391.23 27684 29462 4771175 4771175 0.00
 
 

Action details: flametongue_attack

Static Values
  • id:10444
  • school:fire
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:{$@spelldesc193796=Scorches your target, dealing {$s2=1} Fire damage, and enhances your weapons with fire for {$194084d=16 seconds}, causing each weapon attack to deal up to ${$<coeff>*$AP} Fire damage, based on weapon speed.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Frostbrand 8881 (120278) 0.7% (9.2%) 18.9 16.19sec 1903256 1794366 Direct 18.9 118716 237012 140930 18.8% 0.0%  

Stats details: frostbrand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.91 18.91 87.03 0.00 1.0607 3.3237 2664945.31 2664945.31 0.00 116356.36 1794366.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.36 81.22% 118715.87 111001 130010 118771.01 115140 124896 1823298 1823298 0.00
crit 3.55 18.78% 237011.85 222001 260020 232662.01 0 260020 841647 841647 0.00
 
 

Action details: frostbrand

Static Values
  • id:196834
  • school:frost
  • resource:maelstrom
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.hailstorm.enabled&!buff.frostbrand.up&variable.furyCheck45
Spelldata
  • id:196834
  • name:Frostbrand
  • school:frost
  • tooltip:Melee attacks reduce target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
  • description:Chills your target, dealing {$s1=1} Frost damage and reducing the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}, and enhances your weapons with frost for {$d=16 seconds}, causing each weapon attack to reduce the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.925000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.00
  • base_tick_time:5.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Hailstorm 111397 8.5% 892.1 0.60sec 37355 0 Direct 892.1 31501 63002 37354 18.6% 0.0%  

Stats details: hailstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 892.11 892.11 0.00 0.00 0.0000 0.0000 33324658.25 33324658.25 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 726.35 81.42% 31501.06 27837 33735 31510.42 30925 32189 22880829 22880829 0.00
crit 165.77 18.58% 63002.44 56510 67470 63019.58 61829 64473 10443829 10443829 0.00
 
 

Action details: hailstorm

Static Values
  • id:210854
  • school:frost
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210854
  • name:Hailstorm
  • school:frost
  • tooltip:
  • description:{$@spelldesc210853=Frostbrand now also enhances your weapon's damage, causing each of your weapon attacks to also deal $210854sw1 Frost damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.30
 
Lava Lash 114221 (127400) 8.8% (9.8%) 45.5 6.25sec 841977 793257 Direct 45.5 636112 1273241 754709 18.6% 0.0%  

Stats details: lava_lash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.49 45.49 0.00 0.00 1.0614 0.0000 34329079.70 34329079.70 0.00 793257.10 793257.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.02 81.39% 636111.96 454911 1478679 641282.12 549944 826764 23548082 23548082 0.00
crit 8.47 18.61% 1273240.56 909823 2957357 1283599.37 0 2515392 10780998 10780998 0.00
 
 

Action details: lava_lash

Static Values
  • id:60103
  • school:fire
  • resource:maelstrom
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.hot_hand.react&((variable.akainuEquipped&buff.frostbrand.up)|!variable.akainuEquipped)
Spelldata
  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing $sw1 Fire damage.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:7.81
 
    Doom Vortex (_ll) 13179 1.0% 54.1 4.88sec 73333 0 Direct 54.1 61844 123718 73336 18.6% 0.0%  

Stats details: doom_vortex_ll

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.12 54.12 0.00 0.00 0.0000 0.0000 3968579.61 3968579.61 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.07 81.43% 61843.94 53634 67845 61882.23 58813 66731 2725317 2725317 0.00
crit 10.05 18.57% 123717.53 107269 135691 123772.45 0 135691 1243262 1243262 0.00
 
 

Action details: doom_vortex_ll

Static Values
  • id:199116
  • school:fire
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:199116
  • name:Doom Vortex
  • school:fire
  • tooltip:
  • description:{$@spelldesc199107=Lava Lash{$?s210727=false}[ and Lightning Bolt have][ has] a chance to cause |cFFFFCC99Doomhammer|r to release a fiery tornado at your target's location, dealing ${3*{$199116s1=1}} Fire damage over {$199121d=3 seconds} to enemies within $199116A1 yards.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.600000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
main_hand 18820 1.4% 132.9 2.26sec 42660 27039 Direct 132.9 42789 85584 42660 18.6% 18.9%  

Stats details: main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 132.89 132.89 0.00 0.00 1.5777 0.0000 5669153.09 8334192.03 31.98 27039.10 27039.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 82.98 62.44% 42788.86 37865 46041 42804.71 42022 44080 3550704 5219871 31.98
crit 24.75 18.63% 85583.91 76867 92082 85616.72 83249 88811 2118450 3114321 31.98
miss 25.16 18.93% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Mark of the Hidden Satyr 20828 1.6% 20.5 14.62sec 304783 0 Direct 20.5 257334 514293 304783 18.5% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.47 20.47 0.00 0.00 0.0000 0.0000 6237989.99 6237989.99 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.69 81.54% 257334.32 223468 282681 257426.16 245860 271077 4294464 4294464 0.00
crit 3.78 18.46% 514293.04 446936 565361 500945.51 0 565361 1943526 1943526 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
offhand 9365 0.7% 132.3 2.26sec 21329 13470 Direct 132.3 21408 42815 21329 18.5% 18.9%  

Stats details: offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 132.33 132.33 0.00 0.00 1.5835 0.0000 2822561.61 4149432.92 31.98 13469.63 13469.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 82.80 62.57% 21408.35 19217 23021 21416.20 21044 21998 1772681 2606010 31.98
crit 24.52 18.53% 42815.12 38433 46041 42831.96 41659 44727 1049880 1543423 31.98
miss 25.01 18.90% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: offhand

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Rockbiter 100322 7.7% 57.9 5.13sec 521773 487621 Direct 57.9 440295 880609 521789 18.5% 0.0%  

Stats details: rockbiter

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.86 57.86 0.00 0.00 1.0701 0.0000 30192003.61 30192003.61 0.00 487620.58 487620.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 47.16 81.50% 440295.19 406397 483136 440538.84 429945 457904 20763143 20763143 0.00
crit 10.71 18.50% 880609.17 812794 966273 881011.61 837361 966273 9428860 9428860 0.00
 
 

Action details: rockbiter

Static Values
  • id:193786
  • school:nature
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.landslide.enabled&!buff.landslide.up
Spelldata
  • id:193786
  • name:Rockbiter
  • school:nature
  • tooltip:
  • description:Assaults your target with earthen power, dealing {$s1=0} Nature damage. |cFFFFFFFFGenerates {$s2=25} Maelstrom.|r
 
Stormlash 38268 2.9% 701.0 1.08sec 16348 0 Direct 701.0 16349 0 16349 0.0% 0.0%  

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 701.00 701.00 0.00 0.00 0.0000 0.0000 11460126.01 11460126.01 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 701.00 100.00% 16348.66 2717 89086 16348.69 13854 18620 11460126 11460126 0.00
 
 

Action details: stormlash

Static Values
  • id:213307
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:213307
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:{$@spelldesc195255=While your weapons are enhanced, your attacks have a chance to grant Stormlash to up to {$?s210731=false}[${$m1+$210731m1}][{$s1=2}] party or raid members for {$195222d=8 seconds}, causing attacks and spellcasts to deal additional Nature damage.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:2.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:16153.22
  • base_dd_max:16153.22
 
Stormstrike 0 (255895) 0.0% (19.6%) 73.9 3.74sec 1041572 965624

Stats details: stormstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.85 0.00 0.00 0.00 1.0787 0.0000 0.00 0.00 0.00 965623.67 965623.67
 
 

Action details: stormstrike

Static Values
  • id:17364
  • school:physical
  • resource:maelstrom
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.stormbringer.up&variable.furyCheck25
Spelldata
  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of ${$32175sw1+$32176sw1} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
    Stormstrike (_mh) 170586 13.1% 92.2 3.74sec 555992 0 Direct 92.2 366097 889938 556010 36.2% 0.0%  

Stats details: stormstrike_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.23 92.23 0.00 0.00 0.0000 0.0000 51278667.34 75384498.24 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.80 63.75% 366097.16 150336 572971 366672.05 314162 421328 21526771 31646392 31.98
crit 33.43 36.25% 889938.34 300671 1145942 890814.44 678736 1009776 29751896 43738106 31.98
 
 

Action details: stormstrike_mh

Static Values
  • id:32175
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of ${$32175sw1+$32176sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:7.50
 
    Stormstrike Off-Hand 85309 6.5% 92.2 3.74sec 278066 0 Direct 92.2 182903 445519 278068 36.2% 0.0%  

Stats details: stormstrike_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.23 92.23 0.00 0.00 0.0000 0.0000 25645811.45 37701772.07 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.81 63.77% 182902.59 75168 286486 183179.78 138618 218615 10756908 15813673 31.98
crit 33.42 36.23% 445518.81 150336 572971 445842.98 344002 500863 14888904 21888099 31.98
 
 

Action details: stormstrike_offhand

Static Values
  • id:32176
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of ${$32175sw1+$32176sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:7.50
 
Unleash Lava 45221 3.4% 126.4 3.20sec 106439 0 Direct 124.8 90883 181789 107810 18.6% 0.0%  

Stats details: unleash_lava

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 126.43 124.82 0.00 0.00 0.0000 0.0000 13456534.94 13456534.94 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 101.58 81.38% 90883.36 78663 99506 90916.95 87984 94726 9232322 9232322 0.00
crit 23.24 18.62% 181789.37 157326 199012 181839.29 173697 191864 4224213 4224213 0.00
 
 

Action details: unleash_lava

Static Values
  • id:199053
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:1.2000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:199053
  • name:Unleash Lava
  • school:fire
  • tooltip:
  • description:{$@spelldesc198736=Stormstrike has a chance to unleash the power of |cFFFFCC99Doomhammer|r, causing your special attacks to heave molten lava or lightning spikes at your target for {$199053s1=1} Fire or Nature damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.800000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Unleash Lightning 45451 3.5% 127.1 3.18sec 106479 0 Direct 125.5 90896 181764 107772 18.6% 0.0%  

Stats details: unleash_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 127.06 125.53 0.00 0.00 0.0000 0.0000 13529134.21 13529134.21 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 102.22 81.43% 90895.71 78663 99506 90930.04 87564 94814 9291454 9291454 0.00
crit 23.31 18.57% 181763.90 157326 199012 181841.83 171541 191637 4237680 4237680 0.00
 
 

Action details: unleash_lightning

Static Values
  • id:199054
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:1.2000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:199054
  • name:Unleash Lightning
  • school:nature
  • tooltip:
  • description:{$@spelldesc198736=Stormstrike has a chance to unleash the power of |cFFFFCC99Doomhammer|r, causing your special attacks to heave molten lava or lightning spikes at your target for {$199053s1=1} Fire or Nature damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.800000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Windlash (wind_lash) 13754 1.0% 54.2 4.96sec 75063 57466 Direct 54.2 63222 126485 75064 18.7% 0.0%  

Stats details: wind_lash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.23 54.23 0.00 0.00 1.3062 0.0000 4070371.87 4070371.87 0.00 57465.97 57465.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.08 81.28% 63222.10 56501 67685 63270.07 61143 66547 2786705 2786705 0.00
crit 10.15 18.72% 126485.15 113001 135370 126570.97 118054 135370 1283667 1283667 0.00
 
 

Action details: wind_lash

Static Values
  • id:114089
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114089
  • name:Windlash
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals $sw1 Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Windlash Off-Hand (wind_lash_offhand) 6881 0.5% 54.3 4.96sec 37539 28790 Direct 54.3 31614 63224 37537 18.7% 0.0%  

Stats details: wind_lash_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.26 54.26 0.00 0.00 1.3039 0.0000 2036688.48 2036688.48 0.00 28789.56 28789.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.09 81.26% 31613.51 28250 33842 31636.58 30516 33257 1393733 1393733 0.00
crit 10.17 18.74% 63223.93 56501 67685 63243.61 0 67685 642956 642956 0.00
 
 

Action details: wind_lash_offhand

Static Values
  • id:114093
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114093
  • name:Windlash Off-Hand
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals $sw1 Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Windfury Attack 69637 5.3% 178.8 3.39sec 116278 0 Direct 178.8 98106 195548 116275 18.6% 0.0%  

Stats details: windfury_attack

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 178.84 178.84 0.00 0.00 0.0000 0.0000 20795024.85 30570656.30 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 145.49 81.35% 98106.13 55030 200065 98351.02 82742 117140 14274184 20984402 31.98
crit 33.35 18.65% 195548.29 111710 400130 195915.59 131387 280761 6520841 9586254 31.98
 
 

Action details: windfury_attack

Static Values
  • id:25504
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Each of your main hand attacks has a {$33757h=20}% chance to trigger two extra attacks, dealing $25504sw2 Physical damage each.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Windfury Attack (_oh) 14185 1.1% 38.3 14.85sec 110732 0 Direct 38.3 93583 187134 110733 18.3% 0.0%  

Stats details: windfury_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.26 38.26 0.00 0.00 0.0000 0.0000 4237090.84 6228924.89 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.25 81.67% 93582.55 83783 100032 93621.46 89832 98518 2924522 4299325 31.98
crit 7.01 18.33% 187134.32 167566 200065 187091.50 0 200065 1312569 1929600 31.96
 
 

Action details: windfury_attack_oh

Static Values
  • id:33750
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:33750
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:$@spelldesc8232
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Windstrike 0 (264853) 0.0% (20.0%) 53.9 4.98sec 1449279 1480042

Stats details: windstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.93 0.00 0.00 0.00 0.9792 0.0000 0.00 0.00 0.00 1480042.26 1480042.26
 
 

Action details: windstrike

Static Values
  • id:115356
  • school:physical
  • resource:maelstrom
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(variable.heartEquipped|set_bonus.tier19_2pc)&(!talent.earthen_spike.enabled|(cooldown.earthen_spike.remains>1&cooldown.doom_winds.remains>1)|debuff.earthen_spike.up)
Spelldata
  • id:115356
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:Hurl a staggering blast of wind at an enemy, dealing a total of ${$115357sw1+$115360sw1} Physical damage, bypassing armor.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
    Windstrike (_mh) 176554 13.3% 67.4 4.98sec 773399 0 Direct 67.4 533027 1273723 773561 32.5% 0.0%  

Stats details: windstrike_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 67.36 67.35 0.00 0.00 0.0000 0.0000 52097762.36 52097762.36 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.48 67.53% 533027.39 209035 842322 534659.06 437355 637278 24244195 24244195 0.00
crit 21.87 32.47% 1273723.19 418069 1684644 1276562.24 962231 1485378 27853567 27853567 0.00
 
 

Action details: windstrike_mh

Static Values
  • id:115357
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115357
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of ${$115357sw1+$115360sw1} Physical damage, bypassing armor.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:7.50
 
    Windstrike Off-Hand 88299 6.7% 67.4 4.98sec 386847 0 Direct 67.4 266301 637750 386921 32.5% 0.0%  

Stats details: windstrike_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 67.36 67.35 0.00 0.00 0.0000 0.0000 26058829.31 26058829.31 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 45.48 67.53% 266300.88 104517 421161 267107.50 217550 320083 12112149 12112149 0.00
crit 21.87 32.47% 637750.48 209035 842322 639532.57 505589 753078 13946680 13946680 0.00
 
 

Action details: windstrike_offhand

Static Values
  • id:115360
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115360
  • name:Windstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of ${$115357sw1+$115360sw1} Physical damage, bypassing armor.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:7.50
 
pet - frost_wolf 308962 / 18733
Frozen Bite 141554 0.7% 8.1 29.74sec 318604 0 Direct 8.1 268775 536965 318632 18.6% 0.0%  

Stats details: frozen_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.10 8.10 0.00 0.00 0.0000 0.0000 2580527.74 2580527.74 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.59 81.42% 268774.52 236633 294910 267983.92 0 294910 1772433 1772433 0.00
crit 1.50 18.58% 536964.92 473265 589819 400986.24 0 589819 808095 808095 0.00
 
 

Action details: frozen_bite

Static Values
  • id:224126
  • school:frost
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224126
  • name:Frozen Bite
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Bite the target, causing {$s1=1} Frost damage and slowing the target's movement speed by {$s2=50}% for {$d=4 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
melee 100102 0.5% 46.8 4.56sec 38858 46156 Direct 46.8 32757 65451 38859 18.7% 0.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.80 46.80 0.00 0.00 0.8419 0.0000 1818637.25 2673569.03 31.98 46155.96 46155.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.07 81.34% 32756.88 28640 35693 32691.76 0 35546 1246986 1833187 31.96
crit 8.73 18.66% 65451.40 57279 71386 64717.13 0 71386 571651 840382 31.66
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Snowstorm 67306 0.3% 14.3 14.84sec 85669 0 Direct 14.3 72062 144308 85665 18.8% 0.0%  

Stats details: snowstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.28 14.28 0.00 0.00 0.0000 0.0000 1223738.74 1223738.74 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.59 81.16% 72062.07 63102 78642 71426.50 0 78642 835475 835475 0.00
crit 2.69 18.84% 144308.39 126203 157284 126731.63 0 157284 388264 388264 0.00
 
 

Action details: snowstorm

Static Values
  • id:198483
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198483
  • name:Snowstorm
  • school:frost
  • tooltip:
  • description:Deals {$s1=0} Frost damage to all targets within $A1 yards.
 
pet - fiery_wolf 382849 / 24138
Fiery Jaws 217409 1.0% 8.3 30.08sec 496805 0 Direct 8.3 179170 359147 212677 18.6% 0.0%  
Periodic 32.7 71829 0 71829 0.0% 0.0% 10.9%

Stats details: fiery_jaws

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.27 8.27 32.71 32.71 0.0000 1.0000 4108540.85 4108540.85 0.00 125608.88 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.73 81.37% 179169.89 157756 196607 178730.18 0 196607 1205600 1205600 0.00
crit 1.54 18.63% 359147.15 315511 393214 272065.88 0 393214 553457 553457 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.7 100.00% 71829.15 63103 78644 71703.09 0 78644 2349484 2349484 0.00
 
 

Action details: fiery_jaws

Static Values
  • id:224125
  • school:fire
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224125
  • name:Fiery Jaws
  • school:fire
  • tooltip:Suffering {$s2=1} Fire damage every $t sec.
  • description:Bite the target for {$s1=1} Fire damage, causing an additional $o2 Fire damage over {$d=4 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.400000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Fire Nova 66547 0.3% 14.6 15.00sec 85511 0 Direct 14.6 72134 144111 85514 18.6% 0.0%  

Stats details: fire_nova

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.62 14.62 0.00 0.00 0.0000 0.0000 1250139.03 1250139.03 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.90 81.41% 72133.87 63102 78642 71785.45 0 78642 858544 858544 0.00
crit 2.72 18.59% 144111.11 126203 157284 127270.17 0 157284 391595 391595 0.00
 
 

Action details: fire_nova

Static Values
  • id:198480
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198480
  • name:Fire Nova
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to all targets within $A1 yards.
 
melee 98893 0.5% 47.9 4.57sec 38825 46246 Direct 47.9 32776 65553 38825 18.5% 0.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.94 47.94 0.00 0.00 0.8395 0.0000 1861207.38 2736151.14 31.98 46245.77 46245.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.09 81.54% 32775.91 28640 35693 32739.22 0 35693 1281193 1883476 31.96
crit 8.85 18.46% 65553.39 57279 71386 65109.73 0 71386 580014 852676 31.78
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lightning_wolf 248621 / 14703
melee 147522 0.7% 48.1 4.58sec 54094 64485 Direct 48.1 45590 91200 54092 18.6% 0.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.07 48.07 0.00 0.00 0.8389 0.0000 2600438.81 3822891.37 31.98 64485.41 64485.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.11 81.36% 45589.60 28640 53539 45547.52 36086 50235 1783019 2621207 31.98
crit 8.96 18.64% 91199.80 57279 107079 90511.02 0 107079 817420 1201684 31.76
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Thunder Bite 101098 0.5% 14.5 15.00sec 123568 0 Direct 14.5 104351 208664 123568 18.4% 0.0%  

Stats details: thunder_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.52 14.52 0.00 0.00 0.0000 0.0000 1794371.10 1794371.10 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.85 81.58% 104350.85 63102 117963 103858.96 0 117963 1236182 1236182 0.00
crit 2.68 18.42% 208663.80 126203 235926 185265.08 0 235926 558189 558189 0.00
 
 

Action details: thunder_bite

Static Values
  • id:198485
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198485
  • name:Thunder Bite
  • school:nature
  • tooltip:
  • description:Deals {$s1=0} Nature damage, jumping to up to $x targets.
 
Simple Action Stats Execute Interval
T19 2pc
Ascendance 2.0 184.98sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.04 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114051
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.doom_winds.up
Spelldata
  • id:114051
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a $114089r yard range. Stormstrike is empowered and has a $114089r yard range.
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, reducing the cooldown and cost of Stormstrike by {$s4=80}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$s1=30} yd range.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T19 2pc
  • harmful:false
  • if_expr:
 
Berserking 2.0 189.47sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.03 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ascendance.up|(feral_spirit.remains>5)|level<100
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Doom Winds 5.3 61.63sec

Stats details: doom_winds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.34 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: doom_winds

Static Values
  • id:204945
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:debuff.earthen_spike.up&talent.earthen_spike.enabled|!talent.earthen_spike.enabled
Spelldata
  • id:204945
  • name:Doom Winds
  • school:physical
  • tooltip:Chance to proc Windfury weapon on auto attacks increased by 100%. Windfury damage increased by {$s2=200}%.
  • description:Unleashes the inner power of the |cFFFFCC99Doomhammer|r, causing all auto attacks to trigger Windfury, and increasing damage dealt by Windfury by {$s2=200}% for {$d=6 seconds}.
 
Feral Spirit 3.0 121.02sec

Stats details: feral_spirit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.97 0.00 0.00 0.00 1.0192 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: feral_spirit

Static Values
  • id:51533
  • school:nature
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects$?a231723[ and grant you {$190185s1=5} Maelstrom each time they attack][].
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T19 2pc
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T19 2pc
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
pet - lightning_wolf
Crackling Surge 8.3 30.29sec

Stats details: crackling_surge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.32 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: crackling_surge

Static Values
  • id:224127
  • school:nature
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224127
  • name:Crackling Surge
  • school:nature
  • tooltip:Damage dealt increased by {$s1=50}%.
  • description:The Doom Wolf surges with electric energy, increasing all damage dealt by {$s1=50}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 6.3 0.1 48.2sec 47.0sec 27.23% 87.95% 0.1(0.1) 6.1

Buff details

  • buff initial source:T19 2pc
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:27.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114051
  • name:Ascendance
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a $114089r yard range. Stormstrike is empowered and has a $114089r yard range.
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, reducing the cooldown and cost of Stormstrike by {$s4=80}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$s1=30} yd range.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Berserking 2.0 0.0 189.7sec 189.7sec 6.82% 11.86% 0.0(0.0) 2.0

Buff details

  • buff initial source:T19 2pc
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.59% 13.59% 0.0(0.0) 1.0

Buff details

  • buff initial source:T19 2pc
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Chill of the Twisting Nether 1.1 925.4 156.2sec 0.3sec 99.28% 99.34% 925.4(925.4) 0.1

Buff details

  • buff initial source:T19 2pc
  • cooldown name:buff_chill_of_the_twisting_nether
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02

Stack Uptimes

  • chill_of_the_twisting_nether_1:99.28%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:207998
  • name:Chill of the Twisting Nether
  • tooltip:All damage done increased by ${{$s1=15}/10}.1%.
  • description:{$@spelldesc207994=Damaging enemies with your Fire, Frost, or Nature abilities increases all damage you deal by ${{$207995s1=15}/10}.1% for {$207995d=8 seconds}. Each element adds a separate application.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Concordance of the Legionfall 8.2 3.2 35.8sec 25.1sec 32.02% 32.02% 3.2(3.2) 7.9

Buff details

  • buff initial source:T19 2pc
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Doom Winds 5.3 0.0 61.7sec 61.7sec 10.50% 19.43% 0.0(0.0) 5.2

Buff details

  • buff initial source:T19 2pc
  • cooldown name:buff_doom_winds
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • doom_winds_1:10.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:204945
  • name:Doom Winds
  • tooltip:Chance to proc Windfury weapon on auto attacks increased by 100%. Windfury damage increased by {$s2=200}%.
  • description:Unleashes the inner power of the |cFFFFCC99Doomhammer|r, causing all auto attacks to trigger Windfury, and increasing damage dealt by Windfury by {$s2=200}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:60.00
  • default_chance:0.00%
Fire of the Twisting Nether 1.0 1133.2 153.0sec 0.3sec 99.62% 99.69% 1133.2(1133.2) 0.0

Buff details

  • buff initial source:T19 2pc
  • cooldown name:buff_fire_of_the_twisting_nether
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02

Stack Uptimes

  • fire_of_the_twisting_nether_1:99.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:207995
  • name:Fire of the Twisting Nether
  • tooltip:All damage done increased by ${{$s1=15}/10}.1%.
  • description:{$@spelldesc207994=Damaging enemies with your Fire, Frost, or Nature abilities increases all damage you deal by ${{$207995s1=15}/10}.1% for {$207995d=8 seconds}. Each element adds a separate application.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Flametongue 4.7 15.1 63.0sec 15.4sec 98.37% 98.46% 30.1(30.1) 3.8

Buff details

  • buff initial source:T19 2pc
  • cooldown name:buff_flametongue
  • max_stacks:1
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • flametongue_1:98.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194084
  • name:Flametongue
  • tooltip:Each of your weapon attacks causes up to ${$<coeff>*$AP} additional Fire damage.
  • description:{$@spelldesc193796=Scorches your target, dealing {$s2=1} Fire damage, and enhances your weapons with fire for {$194084d=16 seconds}, causing each weapon attack to deal up to ${$<coeff>*$AP} Fire damage, based on weapon speed.}
  • max_stacks:0
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
Frostbrand 7.0 11.9 42.9sec 16.2sec 96.84% 97.12% 45.8(45.8) 6.0

Buff details

  • buff initial source:T19 2pc
  • cooldown name:buff_frostbrand
  • max_stacks:1
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • frostbrand_1:96.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196834
  • name:Frostbrand
  • tooltip:Melee attacks reduce target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
  • description:Chills your target, dealing {$s1=1} Frost damage and reducing the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}, and enhances your weapons with frost for {$d=16 seconds}, causing each weapon attack to reduce the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
  • max_stacks:0
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
Gathering Storms 9.7 1.9 30.0sec 24.7sec 10.85% 7.64% 1.9(1.9) 0.0

Buff details

  • buff initial source:T19 2pc
  • cooldown name:buff_gathering_storms
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • gathering_storms_1:10.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:198300
  • name:Gathering Storms
  • tooltip:Damage of Stormstrike increased by $w1%.
  • description:{$@spelldesc198299=Each target hit by Crash Lightning increases damage dealt by your next Stormstrike within {$198300d=12 seconds} by {$s1=2}%.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Landslide 7.7 50.1 38.5sec 5.1sec 96.10% 90.17% 50.1(50.1) 6.8

Buff details

  • buff initial source:T19 2pc
  • cooldown name:buff_landslide
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • landslide_1:96.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202004
  • name:Landslide
  • tooltip:Agility increased by {$s1=8}%.
  • description:{$@spelldesc197992=$?s201897[Boulderfist][Rockbiter] enhances your weapon, increasing your Agility by {$202004s1=8}% for {$202004d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 106.1sec 0.0sec 40.07% 40.07% 0.0(0.0) 2.0

Buff details

  • buff initial source:T19 2pc
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:40.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Shock of the Twisting Nether 2.2 204.7 113.9sec 1.4sec 99.17% 99.04% 204.7(204.7) 1.2

Buff details

  • buff initial source:T19 2pc
  • cooldown name:buff_shock_of_the_twisting_nether
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02

Stack Uptimes

  • shock_of_the_twisting_nether_1:99.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:207999
  • name:Shock of the Twisting Nether
  • tooltip:All damage done increased by ${{$s1=15}/10}.1%.
  • description:{$@spelldesc207994=Damaging enemies with your Fire, Frost, or Nature abilities increases all damage you deal by ${{$207995s1=15}/10}.1% for {$207995d=8 seconds}. Each element adds a separate application.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 63.8 6.9 4.7sec 4.2sec 20.27% 49.79% 10.7(11.3) 0.0

Buff details

  • buff initial source:T19 2pc
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormbringer_1:20.27%

Trigger Attempt Success

  • trigger_pct:94.09%

Spelldata details

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike has no cooldown and its cost is reduced by {$s3=50}%.
  • description:{$@spelldesc201845=Your weapon attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike, and cause your next Stormstrike to cost {$201846s3=50}% less Maelstrom and trigger no cooldown.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Stormlash 14.1 10.6 21.6sec 12.1sec 50.38% 50.38% 10.6(10.6) 13.6

Buff details

  • buff initial source:T19 2pc
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormlash_1:50.38%

Trigger Attempt Success

  • trigger_pct:99.89%

Spelldata details

  • id:195222
  • name:Stormlash
  • tooltip:Empowered with lightning. Attacks and spellcasts have a chance to deal additional Nature damage.
  • description:{$@spelldesc195255=While your weapons are enhanced, your attacks have a chance to grant Stormlash to up to {$?s210731=false}[${$m1+$210731m1}][{$s1=2}] party or raid members for {$195222d=8 seconds}, causing attacks and spellcasts to deal additional Nature damage.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Unleash Doom 15.6 16.2 19.2sec 9.2sec 44.43% 50.61% 16.2(16.2) 15.2

Buff details

  • buff initial source:T19 2pc
  • cooldown name:buff_unleash_doom
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-0.00

Stack Uptimes

  • unleash_doom_1:44.43%

Trigger Attempt Success

  • trigger_pct:19.96%

Spelldata details

  • id:199055
  • name:Unleash Doom
  • tooltip:Your special attacks will trigger an arc of fiery or lightning damage at your target.
  • description:{$@spelldesc198736=Stormstrike has a chance to unleash the power of |cFFFFCC99Doomhammer|r, causing your special attacks to heave molten lava or lightning spikes at your target for {$199053s1=1} Fire or Nature damage.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Wind Strikes 16.4 54.3 18.5sec 4.2sec 70.64% 78.53% 54.9(58.6) 15.7

Buff details

  • buff initial source:T19 2pc
  • cooldown name:buff_wind_strikes
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.85

Stack Uptimes

  • wind_strikes_1:70.64%

Trigger Attempt Success

  • trigger_pct:94.10%

Spelldata details

  • id:198293
  • name:Wind Strikes
  • tooltip:Attack speed increased by $w1%.
  • description:{$@spelldesc198292=When Stormbringer resets the remaining cooldown on Stormstrike, you gain {$s1=3}% attack speed for {$198293d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
fiery_wolf: Alpha Wolf 1.7 0.6 96.9sec 54.3sec 74.67% 74.67% 8.0(8.0) 0.8

Buff details

  • buff initial source:T19 2pc_fiery_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:74.67%

Trigger Attempt Success

  • trigger_pct:98.97%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
fiery_wolf: Alpha Wolf 1.5 0.9 104.9sec 44.0sec 76.43% 76.43% 8.1(8.1) 0.6

Buff details

  • buff initial source:T19 2pc_fiery_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:76.43%

Trigger Attempt Success

  • trigger_pct:98.18%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
frost_wolf: Alpha Wolf 1.6 0.6 93.0sec 51.0sec 74.68% 74.68% 7.6(7.6) 0.7

Buff details

  • buff initial source:T19 2pc_frost_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:74.68%

Trigger Attempt Success

  • trigger_pct:98.14%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
frost_wolf: Alpha Wolf 1.5 0.9 110.4sec 44.4sec 76.12% 76.12% 8.1(8.1) 0.6

Buff details

  • buff initial source:T19 2pc_frost_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:76.12%

Trigger Attempt Success

  • trigger_pct:98.03%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Alpha Wolf 1.6 0.6 99.8sec 54.7sec 74.23% 74.23% 7.8(7.8) 0.7

Buff details

  • buff initial source:T19 2pc_lightning_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:74.23%

Trigger Attempt Success

  • trigger_pct:98.15%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Alpha Wolf 1.6 0.9 104.9sec 44.9sec 76.30% 76.30% 8.3(8.3) 0.6

Buff details

  • buff initial source:T19 2pc_lightning_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:76.30%

Trigger Attempt Success

  • trigger_pct:98.41%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Crackling Surge 4.2 0.0 23.6sec 23.6sec 75.95% 71.06% 0.0(0.0) 2.8

Buff details

  • buff initial source:T19 2pc_lightning_wolf
  • cooldown name:buff_crackling_surge
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • crackling_surge_1:75.95%

Trigger Attempt Success

  • trigger_pct:99.61%

Spelldata details

  • id:224127
  • name:Crackling Surge
  • tooltip:Damage dealt increased by {$s1=50}%.
  • description:The Doom Wolf surges with electric energy, increasing all damage dealt by {$s1=50}%.
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Crackling Surge 4.2 0.0 23.2sec 23.2sec 76.19% 71.32% 0.0(0.0) 2.8

Buff details

  • buff initial source:T19 2pc_lightning_wolf
  • cooldown name:buff_crackling_surge
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • crackling_surge_1:76.19%

Trigger Attempt Success

  • trigger_pct:99.89%

Spelldata details

  • id:224127
  • name:Crackling Surge
  • tooltip:Damage dealt increased by {$s1=50}%.
  • description:The Doom Wolf surges with electric energy, increasing all damage dealt by {$s1=50}%.
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:T19 2pc
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:T19 2pc
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:T19 2pc
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201639
  • name:Well Fed
  • tooltip:Agility increased by $w1.
  • description:Agility increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Strength of Will

Buff details

  • buff initial source:T19 2pc
  • cooldown name:buff_strength_of_will
  • max_stacks:10
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:304.77

Stack Uptimes

  • strength_of_will_10:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242642
  • name:Strength of Will
  • tooltip:Strength or Agility increased by {$s3=95}, based on your specialization.
  • description:{$@spelldesc242640=While you are above {$s1=80}% health you gain {$242642s3=95} Strength or Agility per second, based on your specialization, stacking up to {$242642u=10} times. If you fall below {$s2=50}% health, this effect is lost.}
  • max_stacks:10
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
Flametongue: Windfury Attack 214.8 2.8sec
Frostbrand: Windfury Attack 212.6 2.8sec
Maelstrom Weapon: Windfury Attack 217.1 2.8sec
Stormbringer: Windfury Attack 13.3 22.3sec
Stormbringer: Windfury Attack Off-Hand 2.8 74.7sec
Flametongue: main_hand 106.1 2.8sec
Frostbrand: main_hand 104.4 2.8sec
Maelstrom Weapon: main_hand 107.7 2.8sec
Stormbringer: main_hand 8.0 31.7sec
Windfury: main_hand 30.5 9.3sec
Flametongue: Windlash 52.8 5.1sec
Frostbrand: Windlash 51.5 5.2sec
Maelstrom Weapon: Windlash 54.2 5.0sec
Stormbringer: Windlash 4.0 52.7sec
Windfury: Windlash 20.6 13.0sec
Flametongue: offhand 105.8 2.8sec
Frostbrand: offhand 104.8 2.8sec
Maelstrom Weapon: offhand 107.3 2.8sec
Stormbringer: offhand 7.9 31.5sec
Windfury: offhand 8.2 25.5sec
Flametongue: Windlash Off-Hand 52.8 5.1sec
Frostbrand: Windlash Off-Hand 51.5 5.2sec
Maelstrom Weapon: Windlash Off-Hand 54.3 5.0sec
Stormbringer: Windlash Off-Hand 4.1 53.4sec
Windfury: Windlash Off-Hand 11.0 21.6sec
Flametongue: Windstrike 65.2 5.2sec
Frostbrand: Windstrike 63.4 5.3sec
Stormbringer: Windstrike 4.9 46.6sec
Windfury: Windstrike 15.0 18.8sec
Unleash Doom (damage): Windstrike 46.0 7.2sec
Flametongue: Windstrike Off-Hand 65.2 5.2sec
Frostbrand: Windstrike Off-Hand 63.4 5.3sec
Stormbringer: Windstrike Off-Hand 4.9 46.6sec
Unleash Doom (damage): Windstrike Off-Hand 46.0 7.2sec
Stormbringer: Rockbiter 4.3 52.6sec
Unleash Doom (damage): Rockbiter 24.7 11.5sec
Flametongue: Crash Lightning 11.6 24.7sec
Frostbrand: Crash Lightning 11.6 24.8sec
Stormbringer: Crash Lightning 0.8 92.4sec
Windfury: Crash Lightning 2.6 70.1sec
Unleash Doom (damage): Crash Lightning 3.4 62.0sec
Stormbringer: Flametongue 1.5 85.9sec
Unleash Doom (damage): Flametongue 8.6 32.7sec
Stormbringer: Frostbrand 1.4 88.5sec
Unleash Doom (damage): Frostbrand 8.0 35.0sec
Flametongue: Stormstrike 92.2 3.7sec
Frostbrand: Stormstrike 92.2 3.7sec
Stormbringer: Stormstrike 6.9 33.8sec
Windfury: Stormstrike 20.8 13.6sec
Unleash Doom (damage): Stormstrike 51.7 6.5sec
Flametongue: Stormstrike Off-Hand 92.2 3.7sec
Frostbrand: Stormstrike Off-Hand 92.2 3.7sec
Stormbringer: Stormstrike Off-Hand 6.9 34.0sec
Unleash Doom (damage): Stormstrike Off-Hand 51.7 6.5sec
Flametongue: Lava Lash 45.5 6.3sec
Frostbrand: Lava Lash 45.5 6.3sec
Stormbringer: Lava Lash 3.4 59.2sec
Unleash Doom (damage): Lava Lash 13.8 19.5sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Windstrike0.7740.0017.74243.7159.489105.796
Feral Spirit1.1740.00126.5372.0790.00029.314
Doom Winds1.7110.00132.8297.1830.84035.594
Ascendance5.0700.43334.4395.2780.50534.439
Rockbiter3.5140.00119.91356.06422.422114.338
Crash Lightning21.9260.001229.483218.88869.378332.454
Flametongue7.0580.00128.769131.98986.070175.720
Stormstrike1.3700.00112.114111.87233.643207.907

Resources

Resource Usage Type Count Total Average RPE APR
T19 2pc
crash_lightning Maelstrom 20.9 418.0 20.0 35.9 10006.3
frostbrand Maelstrom 34.0 679.2 20.0 35.9 52987.5
lava_lash Maelstrom 81.7 2450.8 30.0 53.9 15626.3
stormstrike Maelstrom 165.6 3849.2 23.2 52.1 19984.4
windstrike Maelstrom 121.0 608.3 5.0 11.3 128483.9
Resource Gains Type Count Total Average Overflow
Windfury Attack Maelstrom 389.89 2142.68 (26.24%) 5.50 586.57 21.49%
Main Hand Maelstrom 193.49 935.56 (11.46%) 4.84 31.91 3.30%
Windlash Maelstrom 97.39 369.44 (4.52%) 3.79 117.49 24.13%
Off-Hand Maelstrom 192.75 928.81 (11.37%) 4.82 34.95 3.63%
Windlash Off-Hand Maelstrom 97.44 364.67 (4.47%) 3.74 122.52 25.15%
Feral Spirit Maelstrom 179.94 589.17 (7.21%) 3.27 310.51 34.51%
Rockbiter Maelstrom 103.92 2836.28 (34.73%) 27.29 177.49 5.89%
Resource RPS-Gain RPS-Loss
Maelstrom 15.14 14.84
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 88.94 0.00 150.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data T19 2pc Fight Length
Count 2497
Mean 300.30
Minimum 197.55
Maximum 394.94
Spread ( max - min ) 197.40
Range [ ( max - min ) / 2 * 100% ] 32.87%
Standard Deviation 42.4022
5th Percentile 235.55
95th Percentile 370.23
( 95th Percentile - 5th Percentile ) 134.68
Mean Distribution
Standard Deviation 0.8486
95.00% Confidence Intervall ( 298.64 - 301.97 )
Normalized 95.00% Confidence Intervall ( 99.45% - 100.55% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 766
0.1% Error 76587
0.1 Scale Factor Error with Delta=300 16
0.05 Scale Factor Error with Delta=300 62
0.01 Scale Factor Error with Delta=300 1535
DPS
Sample Data T19 2pc Damage Per Second
Count 2497
Mean 1310538.59
Minimum 1101596.07
Maximum 1629007.16
Spread ( max - min ) 527411.09
Range [ ( max - min ) / 2 * 100% ] 20.12%
Standard Deviation 73625.3255
5th Percentile 1198011.67
95th Percentile 1435227.82
( 95th Percentile - 5th Percentile ) 237216.15
Mean Distribution
Standard Deviation 1473.3908
95.00% Confidence Intervall ( 1307650.80 - 1313426.39 )
Normalized 95.00% Confidence Intervall ( 99.78% - 100.22% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 122
0.1% Error 12125
0.1 Scale Factor Error with Delta=300 46274116
0.05 Scale Factor Error with Delta=300 185096462
0.01 Scale Factor Error with Delta=300 4627411535
Priority Target DPS
Sample Data T19 2pc Priority Target Damage Per Second
Count 2497
Mean 1310676.02
Minimum 1102469.75
Maximum 1629382.07
Spread ( max - min ) 526912.33
Range [ ( max - min ) / 2 * 100% ] 20.10%
Standard Deviation 72694.0707
5th Percentile 1200705.48
95th Percentile 1431237.06
( 95th Percentile - 5th Percentile ) 230531.57
Mean Distribution
Standard Deviation 1454.7545
95.00% Confidence Intervall ( 1307824.76 - 1313527.29 )
Normalized 95.00% Confidence Intervall ( 99.78% - 100.22% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 119
0.1% Error 11817
0.1 Scale Factor Error with Delta=300 45110917
0.05 Scale Factor Error with Delta=300 180443665
0.01 Scale Factor Error with Delta=300 4511091611
DPS(e)
Sample Data T19 2pc Damage Per Second (Effective)
Count 2497
Mean 1310538.59
Minimum 1101596.07
Maximum 1629007.16
Spread ( max - min ) 527411.09
Range [ ( max - min ) / 2 * 100% ] 20.12%
Damage
Sample Data T19 2pc Damage
Count 2497
Mean 379597353.83
Minimum 301493258.79
Maximum 458809666.08
Spread ( max - min ) 157316407.29
Range [ ( max - min ) / 2 * 100% ] 20.72%
DTPS
Sample Data T19 2pc Damage Taken Per Second
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data T19 2pc Healing Per Second
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data T19 2pc Healing Per Second (Effective)
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data T19 2pc Heal
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data T19 2pc Healing Taken Per Second
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data T19 2pc Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data T19 2pcTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data T19 2pc Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 potion
5 0.00 lightning_shield
Default action list Executed every time the actor is available.
# count action,conditions
0.00 wind_shear
0.00 variable,name=hailstormCheck,value=((talent.hailstorm.enabled&!buff.frostbrand.up)|!talent.hailstorm.enabled)
0.00 variable,name=furyCheck80,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>80))
0.00 variable,name=furyCheck70,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>70))
0.00 variable,name=furyCheck45,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>45))
0.00 variable,name=furyCheck25,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>25))
0.00 variable,name=OCPool70,value=(!talent.overcharge.enabled|(talent.overcharge.enabled&maelstrom>70))
0.00 variable,name=OCPool60,value=(!talent.overcharge.enabled|(talent.overcharge.enabled&maelstrom>60))
0.00 variable,name=heartEquipped,value=(equipped.151819)
0.00 variable,name=akainuEquipped,value=(equipped.137084)
0.00 variable,name=akainuAS,value=(variable.akainuEquipped&buff.hot_hand.react&!buff.frostbrand.up)
0.00 variable,name=LightningCrashNotUp,value=(!buff.lightning_crash.up&set_bonus.tier20_2pc)
0.00 variable,name=alphaWolfCheck,value=((pet.frost_wolf.buff.alpha_wolf.remains<2&pet.fiery_wolf.buff.alpha_wolf.remains<2&pet.lightning_wolf.buff.alpha_wolf.remains<2)&feral_spirit.remains>4)
6 1.00 auto_attack
7 7.16 use_items
8 0.00 call_action_list,name=opener
9 53.93 windstrike,if=(variable.heartEquipped|set_bonus.tier19_2pc)&(!talent.earthen_spike.enabled|(cooldown.earthen_spike.remains>1&cooldown.doom_winds.remains>1)|debuff.earthen_spike.up)
A 0.00 call_action_list,name=buffs
B 0.00 call_action_list,name=CDs
C 0.00 call_action_list,name=core
D 0.00 call_action_list,name=filler
actions.CDs
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
E 2.03 berserking,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
0.00 blood_fury,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
F 1.00 potion,if=buff.ascendance.up|!talent.ascendance.enabled&feral_spirit.remains>5|target.time_to_die<=60
G 2.98 feral_spirit
H 5.34 doom_winds,if=debuff.earthen_spike.up&talent.earthen_spike.enabled|!talent.earthen_spike.enabled
I 2.04 ascendance,if=buff.doom_winds.up
actions.buffs
# count action,conditions
J 6.92 rockbiter,if=talent.landslide.enabled&!buff.landslide.up
0.00 fury_of_air,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
K 2.56 crash_lightning,if=artifact.alpha_wolf.rank&prev_gcd.1.feral_spirit
L 4.74 flametongue,if=!buff.flametongue.up
M 7.02 frostbrand,if=talent.hailstorm.enabled&!buff.frostbrand.up&variable.furyCheck45
N 2.28 flametongue,if=buff.flametongue.remains<6+gcd&cooldown.doom_winds.remains<gcd*2
O 2.66 frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<6+gcd&cooldown.doom_winds.remains<gcd*2
actions.core
# count action,conditions
0.00 earthen_spike,if=variable.furyCheck25
0.00 crash_lightning,if=!buff.crash_lightning.up&active_enemies>=2
0.00 windsong
0.00 crash_lightning,if=active_enemies>=8|(active_enemies>=6&talent.crashing_storm.enabled)
0.00 windstrike
P 40.53 stormstrike,if=buff.stormbringer.up&variable.furyCheck25
0.00 crash_lightning,if=active_enemies>=4|(active_enemies>=2&talent.crashing_storm.enabled)
0.00 lightning_bolt,if=talent.overcharge.enabled&variable.furyCheck45&maelstrom>=40
Q 33.32 stormstrike,if=(!talent.overcharge.enabled&variable.furyCheck45)|(talent.overcharge.enabled&variable.furyCheck80)
0.00 frostbrand,if=variable.akainuAS
0.00 lava_lash,if=buff.hot_hand.react&((variable.akainuEquipped&buff.frostbrand.up)|!variable.akainuEquipped)
0.00 sundering,if=active_enemies>=3
R 2.31 crash_lightning,if=active_enemies>=3|variable.LightningCrashNotUp|variable.alphaWolfCheck
actions.filler
# count action,conditions
S 50.13 rockbiter,if=maelstrom<120
T 10.45 flametongue,if=buff.flametongue.remains<4.8
0.00 rockbiter,if=maelstrom<=40
0.00 crash_lightning,if=(talent.crashing_storm.enabled|active_enemies>=2)&debuff.earthen_spike.up&maelstrom>=40&variable.OCPool60
U 9.23 frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<4.8&maelstrom>40
0.00 frostbrand,if=variable.akainuEquipped&!buff.frostbrand.up&maelstrom>=75
0.00 sundering
V 45.49 lava_lash,if=maelstrom>=50&variable.OCPool70&variable.furyCheck80
0.00 rockbiter
W 6.77 crash_lightning,if=(maelstrom>=65|talent.crashing_storm.enabled|active_enemies>=2)&variable.OCPool60&variable.furyCheck45
X 2.39 flametongue
actions.opener
# count action,conditions
Y 0.81 rockbiter,if=maelstrom<15&time<2

Sample Sequence

012467YLMGKEHI99V9999R9999J9T99999MQSVSVVSVPQSTVSUVVSVQXSVWSV7WX9S9UPQPSQSVWFSVNOHS9999VQS999V9T9UQJVSVSV7VVS999T9U99PJQSVVSTPPQSPMQSPPPGKNOHPQJPQPQ7VPQPQJPQSPLMPPQSPQSSVPQSTUVSVVVSQVVSTUWSV7QSWXVHI9ES9U9V9V9V999J9TVQPQSSUVSVVVSQTPPQSU7SVVVSVWQSTWUPSQGKPQNHSVRPQPQPQSMVPQPPPSLQS7SUVVSPQVSTVVSVUV9S99

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask T19 2pc 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom
Pre precombat 1 food T19 2pc 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom
Pre precombat 2 augmentation T19 2pc 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom potion_of_prolonged_power
0:00.000 default 6 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom potion_of_prolonged_power
0:00.000 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/150: 3% maelstrom potion_of_prolonged_power
0:00.000 opener Y rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/150: 3% maelstrom potion_of_prolonged_power
0:01.105 buffs L flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/150: 26% maelstrom bloodlust, landslide, concordance_of_the_legionfall, shock_of_the_twisting_nether, potion_of_prolonged_power
0:01.955 buffs M frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/150: 29% maelstrom bloodlust, flametongue, landslide, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, potion_of_prolonged_power
0:02.804 CDs G feral_spirit Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/150: 19% maelstrom bloodlust, flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:03.655 buffs K crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/150: 33% maelstrom bloodlust, flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:04.505 CDs E berserking Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/150: 29% maelstrom bloodlust, flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:04.505 CDs H doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/150: 29% maelstrom bloodlust, berserking, flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:04.505 CDs I ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/150: 29% maelstrom bloodlust, berserking, flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, gathering_storms, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:04.505 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/150: 29% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, gathering_storms, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:05.260 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/150: 46% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:06.015 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/150: 82% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:06.770 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/150: 81% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:07.523 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:08.279 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:09.033 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:09.789 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:10.544 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, stormbringer, unleash_doom, wind_strikes, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:11.298 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, stormbringer, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:12.052 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, stormbringer, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:12.807 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:13.562 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:14.318 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:15.073 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:15.925 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:16.775 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:17.626 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:18.478 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, ascendance, flametongue, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:19.330 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, ascendance, flametongue, stormbringer, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:20.180 buffs M frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, flametongue, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:21.032 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:21.885 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:22.737 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 139.0/150: 93% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:23.588 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/150: 76% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:24.439 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 148.0/150: 99% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:25.292 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 142.0/150: 95% maelstrom bloodlust, flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:26.143 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/150: 78% maelstrom bloodlust, flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:26.994 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:27.844 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom bloodlust, flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:28.695 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:29.547 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:30.397 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/150: 63% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:31.250 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/150: 69% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:32.101 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/150: 53% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:32.955 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/150: 79% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:33.806 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/150: 65% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:34.657 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/150: 45% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:35.509 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/150: 25% maelstrom bloodlust, flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:36.363 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/150: 48% maelstrom bloodlust, flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:37.214 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/150: 31% maelstrom bloodlust, flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:38.064 filler X flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/150: 11% maelstrom bloodlust, flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:38.915 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/150: 15% maelstrom bloodlust, flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:39.767 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/150: 34% maelstrom bloodlust, flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:40.619 filler W crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/150: 17% maelstrom bloodlust, flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:41.471 Waiting     0.900 sec 220000.0/220000: 100% mana | 11.0/150: 7% maelstrom ascendance, flametongue, frostbrand, landslide, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:42.371 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom ascendance, flametongue, frostbrand, landslide, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:43.688 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/150: 43% maelstrom ascendance, flametongue, frostbrand, landslide, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:44.793 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/150: 29% maelstrom ascendance, flametongue, frostbrand, landslide, gathering_storms, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:44.793 filler W crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/150: 29% maelstrom ascendance, flametongue, frostbrand, landslide, gathering_storms, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:46.016 filler X flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/150: 29% maelstrom ascendance, flametongue, frostbrand, landslide, gathering_storms, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:47.121 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/150: 32% maelstrom ascendance, flametongue, frostbrand, landslide, gathering_storms, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:48.226 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/150: 39% maelstrom ascendance, flametongue, frostbrand, landslide, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:49.332 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/150: 62% maelstrom ascendance, flametongue, frostbrand, landslide, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:50.435 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom ascendance, flametongue, frostbrand, landslide, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:51.539 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:52.645 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:53.749 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:54.855 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/150: 23% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:55.961 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/150: 42% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:57.066 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/150: 19% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:58.171 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/150: 41% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
0:59.277 filler W crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/150: 25% maelstrom flametongue, frostbrand, landslide, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:00.383 CDs F potion Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/150: 24% maelstrom ascendance, flametongue, frostbrand, landslide, gathering_storms, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:00.383 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/150: 24% maelstrom ascendance, flametongue, frostbrand, landslide, gathering_storms, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:01.489 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom ascendance, flametongue, frostbrand, landslide, gathering_storms, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:02.594 buffs N flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom ascendance, flametongue, frostbrand, landslide, gathering_storms, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:03.699 buffs O frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom ascendance, flametongue, frostbrand, landslide, gathering_storms, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:04.806 CDs H doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom ascendance, flametongue, frostbrand, landslide, gathering_storms, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:04.806 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom ascendance, flametongue, frostbrand, landslide, doom_winds, gathering_storms, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:05.910 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/150: 59% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, gathering_storms, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:07.014 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 136.0/150: 91% maelstrom ascendance, flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:08.118 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 147.0/150: 98% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:09.224 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:10.329 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:11.435 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 139.0/150: 93% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:12.538 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/150: 73% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:13.644 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:14.750 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:15.856 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:16.961 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 147.0/150: 98% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:18.065 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/150: 81% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:19.173 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 138.0/150: 92% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:20.279 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 143.0/150: 95% maelstrom ascendance, flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:21.384 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom ascendance, flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:22.489 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:23.595 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:24.700 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 129.0/150: 86% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:25.806 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/150: 66% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:26.912 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 133.0/150: 89% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:28.019 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/150: 72% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:29.124 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 142.0/150: 95% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:30.230 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/150: 78% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:30.230 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/150: 78% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:31.336 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/150: 61% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:32.443 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/150: 45% maelstrom ascendance, flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:33.547 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom ascendance, flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:34.653 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 126.0/150: 84% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:35.759 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 146.0/150: 97% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:36.865 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 143.0/150: 95% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:37.971 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 148.0/150: 99% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:39.075 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:40.182 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom ascendance, flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:41.287 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 132.0/150: 88% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:42.393 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:43.499 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 144.0/150: 96% maelstrom flametongue, frostbrand, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:44.604 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:45.709 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:46.814 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 144.0/150: 96% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:47.922 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/150: 83% maelstrom flametongue, frostbrand, landslide, unleash_doom, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:49.026 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/150: 63% maelstrom flametongue, frostbrand, landslide, unleash_doom, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:50.132 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/150: 82% maelstrom flametongue, frostbrand, landslide, unleash_doom, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:51.238 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 128.0/150: 85% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:52.342 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/150: 79% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:53.447 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/150: 78% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:54.552 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/150: 55% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:55.656 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/150: 81% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:56.761 buffs M frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/150: 71% maelstrom flametongue, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:57.866 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/150: 57% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:58.970 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, landslide, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:00.074 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/150: 69% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:01.178 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/150: 69% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:02.283 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/150: 81% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:03.387 CDs G feral_spirit Fluffy_Pillow 220000.0/220000: 100% mana | 134.0/150: 89% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:04.491 buffs K crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:05.597 buffs N flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 145.0/150: 97% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:06.703 buffs O frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:07.809 CDs H doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:07.809 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer, landslide, doom_winds, unleash_doom, wind_strikes, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:08.914 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, doom_winds, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:10.020 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer, doom_winds, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:11.125 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:12.230 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, doom_winds, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:13.333 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 139.0/150: 93% maelstrom flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:14.439 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:15.546 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:15.546 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:16.651 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 139.0/150: 93% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:17.754 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 134.0/150: 89% maelstrom flametongue, frostbrand, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:18.858 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/150: 73% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:19.963 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/150: 63% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:21.069 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/150: 49% maelstrom flametongue, frostbrand, stormbringer, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:22.172 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/150: 68% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:23.278 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/150: 71% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:24.384 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:25.490 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/150: 79% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:26.596 buffs L flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 137.0/150: 91% maelstrom frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:27.703 buffs M frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:28.808 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:29.913 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 134.0/150: 89% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:31.020 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/150: 76% maelstrom flametongue, frostbrand, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:32.123 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/150: 62% maelstrom flametongue, frostbrand, landslide, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:33.230 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/150: 81% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:34.335 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/150: 81% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:35.441 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/150: 57% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:36.546 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:37.654 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:38.760 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:39.866 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, landslide, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:40.972 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, landslide, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:42.077 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/150: 76% maelstrom flametongue, frostbrand, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:43.181 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/150: 79% maelstrom flametongue, frostbrand, landslide, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:44.285 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/150: 73% maelstrom flametongue, frostbrand, landslide, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:45.391 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/150: 53% maelstrom flametongue, frostbrand, landslide, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:46.497 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/150: 75% maelstrom flametongue, frostbrand, landslide, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:47.602 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/150: 68% maelstrom flametongue, frostbrand, landslide, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:48.708 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/150: 51% maelstrom flametongue, frostbrand, landslide, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:49.814 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/150: 44% maelstrom flametongue, frostbrand, landslide, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:50.919 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, landslide, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:52.025 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/150: 56% maelstrom flametongue, frostbrand, landslide, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:53.132 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/150: 36% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:54.238 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/150: 16% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:55.343 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/150: 39% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:56.448 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/150: 39% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:57.552 filler W crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/150: 32% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:58.658 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/150: 22% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:59.764 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/150: 45% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:00.872 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/150: 28% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:00.872 Waiting     0.900 sec 220000.0/220000: 100% mana | 42.0/150: 28% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:01.772 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/150: 31% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:03.039 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/150: 5% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:04.145 filler W crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/150: 24% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:05.250 filler X flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:06.356 Waiting     0.700 sec 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:07.056 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:08.162 CDs H doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:08.162 CDs I ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, frostbrand, landslide, doom_winds, gathering_storms, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:08.162 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom ascendance, flametongue, frostbrand, landslide, doom_winds, gathering_storms, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:09.268 CDs E berserking Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/150: 24% maelstrom ascendance, flametongue, frostbrand, landslide, doom_winds, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:09.268 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/150: 24% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:10.231 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/150: 56% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:11.191 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/150: 73% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:12.151 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/150: 72% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:13.114 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 133.0/150: 89% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:14.076 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 141.0/150: 94% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:15.036 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, unleash_doom, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:15.997 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, unleash_doom, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:16.958 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/150: 81% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, unleash_doom, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:17.920 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/150: 65% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, unleash_doom, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:18.881 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/150: 66% maelstrom berserking, ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:19.844 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom ascendance, flametongue, frostbrand, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:20.948 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/150: 65% maelstrom ascendance, flametongue, frostbrand, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:22.055 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:23.161 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:24.267 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:25.372 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:26.477 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/150: 69% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:27.581 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/150: 69% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:28.685 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/150: 45% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:29.789 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/150: 68% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:30.894 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 136.0/150: 91% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:31.999 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 126.0/150: 84% maelstrom flametongue, frostbrand, landslide, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:33.105 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/150: 67% maelstrom flametongue, frostbrand, landslide, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:34.211 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom flametongue, frostbrand, landslide, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:35.317 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, landslide, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:36.422 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, landslide, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:37.528 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/150: 46% maelstrom flametongue, frostbrand, landslide, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:38.632 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/150: 69% maelstrom flametongue, frostbrand, landslide, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:39.737 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/150: 49% maelstrom flametongue, frostbrand, landslide, unleash_doom, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:40.843 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/150: 52% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:41.947 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/150: 51% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:43.052 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/150: 45% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:44.158 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:45.263 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/150: 63% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:46.368 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/150: 53% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:46.368 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/150: 53% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:47.475 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/150: 75% maelstrom flametongue, frostbrand, landslide, unleash_doom, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:48.581 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/150: 59% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:49.686 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/150: 39% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:50.790 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/150: 22% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:51.898 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/150: 48% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:53.002 filler W crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/150: 31% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:54.106 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/150: 27% maelstrom flametongue, frostbrand, landslide, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:55.213 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 6.0/150: 4% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:56.319 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:57.424 filler W crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:58.528 Waiting     0.400 sec 220000.0/220000: 100% mana | 44.0/150: 29% maelstrom flametongue, frostbrand, landslide, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:58.928 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/150: 29% maelstrom flametongue, frostbrand, landslide, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:00.034 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/150: 19% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:01.140 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/150: 13% maelstrom flametongue, frostbrand, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:02.245 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/150: 45% maelstrom flametongue, frostbrand, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:03.351 CDs G feral_spirit Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/150: 31% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:04.492 buffs K crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/150: 44% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:05.597 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:06.703 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/150: 56% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:07.808 buffs N flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/150: 49% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:08.915 CDs H doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/150: 55% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:08.915 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/150: 55% maelstrom flametongue, frostbrand, landslide, doom_winds, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:10.021 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, doom_winds, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:11.128 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 149.0/150: 99% maelstrom flametongue, frostbrand, landslide, doom_winds, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:12.233 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, gathering_storms, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:13.338 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, doom_winds, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:14.444 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:15.549 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:16.657 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:17.764 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:18.870 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:19.976 buffs M frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 149.0/150: 99% maelstrom flametongue, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:21.079 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 134.0/150: 89% maelstrom flametongue, frostbrand, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:22.187 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/150: 76% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:23.293 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/150: 66% maelstrom flametongue, frostbrand, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:24.399 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/150: 43% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:25.505 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/150: 36% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:26.610 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/150: 26% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:27.717 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/150: 25% maelstrom flametongue, frostbrand, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:28.823 buffs L flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/150: 51% maelstrom frostbrand, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:29.929 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/150: 55% maelstrom flametongue, frostbrand, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:31.035 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/150: 41% maelstrom flametongue, frostbrand, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:32.139 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:32.139 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:33.245 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/150: 83% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:34.351 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/150: 73% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:35.457 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/150: 53% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:36.564 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/150: 36% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:37.669 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/150: 62% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:38.775 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/150: 61% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:39.881 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/150: 38% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:40.986 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/150: 25% maelstrom flametongue, frostbrand, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:42.091 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:43.196 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:44.301 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:45.407 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/150: 39% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:46.515 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/150: 59% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:47.619 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/150: 51% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:48.725 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/150: 38% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:49.832 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/150: 21% maelstrom ascendance, flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:50.937 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/150: 32% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:52.043 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/150: 55% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:53.148 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/150: 53% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4728 4403 0
Agility 44332 38901 28018 (24626)
Stamina 81377 81377 45295
Intellect 7649 7324 0
Spirit 1 1 0
Health 4882620 4882620 0
Mana 220000 220000 0
Maelstrom 150 150 0
Spell Power 53198 46681 0
Crit 18.60% 18.60% 3439
Haste 36.17% 36.17% 13565
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 44332 38901 0
Mastery 60.58% 60.58% 8916
Armor 3282 3282 3282
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 939.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of the Skybreaker
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +871 Crit, +515 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Flesh-Raking Leggings
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Mastery }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }, gems: { +150 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Eye of the Twisting Nether
ilevel: 970, stats: { +3515 Sta, +2884 Haste, +1602 Mastery }, gems: { +200 Agi }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Specter of Betrayal
ilevel: 940, stats: { +2994 StrAgi }
Local Trinket2 Cradle of Anguish
ilevel: 930, stats: { +1320 Haste }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Agi }
Local Main Hand Doomhammer
ilevel: 951, weapon: { 8445 - 15685, 2.6 }, stats: { +1496 Agi, +2244 Sta, +435 Crit, +418 Mastery }, relics: { +67 ilevels, +67 ilevels, +67 ilevels }
Local Off Hand Fury of the Stonemother
ilevel: 951, weapon: { 8445 - 15685, 2.6 }, stats: { +1496 Agi, +2244 Sta, +435 Crit, +418 Mastery }

Talents

Level
15 Windsong (Enhancement Shaman) Hot Hand (Enhancement Shaman) Landslide (Enhancement Shaman)
30 Rainfall (Enhancement Shaman) Feral Lunge (Enhancement Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Lightning Shield (Enhancement Shaman) Ancestral Swiftness Hailstorm (Enhancement Shaman)
75 Tempest (Enhancement Shaman) Overcharge (Enhancement Shaman) Empowered Stormlash (Enhancement Shaman)
90 Crashing Storm (Enhancement Shaman) Fury of Air (Enhancement Shaman) Sundering (Enhancement Shaman)
100 Ascendance (Enhancement Shaman) Boulderfist (Enhancement Shaman) Earthen Spike (Enhancement Shaman)

Profile

shaman="T19 2pc"
spec=enhancement
level=110
race=troll
role=attack
position=back
talents=3133111
artifact=41:0:0:0:0:899:1:900:1:901:1:902:1:903:1:904:1:905:4:906:4:907:4:908:4:909:4:910:4:911:4:912:4:913:4:930:1:1351:1:1388:1:1593:4:1594:1:1595:1:1596:1:1687:1

# Default consumables
potion=prolonged_power
flask=seventh_demon
food=lavish_suramar_feast
augmentation=defiled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/lightning_shield

# Executed every time the actor is available.
actions=wind_shear
actions+=/variable,name=hailstormCheck,value=((talent.hailstorm.enabled&!buff.frostbrand.up)|!talent.hailstorm.enabled)
actions+=/variable,name=furyCheck80,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>80))
actions+=/variable,name=furyCheck70,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>70))
actions+=/variable,name=furyCheck45,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>45))
actions+=/variable,name=furyCheck25,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>25))
actions+=/variable,name=OCPool70,value=(!talent.overcharge.enabled|(talent.overcharge.enabled&maelstrom>70))
actions+=/variable,name=OCPool60,value=(!talent.overcharge.enabled|(talent.overcharge.enabled&maelstrom>60))
actions+=/variable,name=heartEquipped,value=(equipped.151819)
actions+=/variable,name=akainuEquipped,value=(equipped.137084)
actions+=/variable,name=akainuAS,value=(variable.akainuEquipped&buff.hot_hand.react&!buff.frostbrand.up)
actions+=/variable,name=LightningCrashNotUp,value=(!buff.lightning_crash.up&set_bonus.tier20_2pc)
actions+=/variable,name=alphaWolfCheck,value=((pet.frost_wolf.buff.alpha_wolf.remains<2&pet.fiery_wolf.buff.alpha_wolf.remains<2&pet.lightning_wolf.buff.alpha_wolf.remains<2)&feral_spirit.remains>4)
actions+=/auto_attack
actions+=/use_items
actions+=/call_action_list,name=opener
actions+=/windstrike,if=(variable.heartEquipped|set_bonus.tier19_2pc)&(!talent.earthen_spike.enabled|(cooldown.earthen_spike.remains>1&cooldown.doom_winds.remains>1)|debuff.earthen_spike.up)
actions+=/call_action_list,name=buffs
actions+=/call_action_list,name=CDs
actions+=/call_action_list,name=core
actions+=/call_action_list,name=filler

actions.CDs=bloodlust,if=target.health.pct<25|time>0.500
actions.CDs+=/berserking,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
actions.CDs+=/blood_fury,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
actions.CDs+=/potion,if=buff.ascendance.up|!talent.ascendance.enabled&feral_spirit.remains>5|target.time_to_die<=60
actions.CDs+=/feral_spirit
actions.CDs+=/doom_winds,if=debuff.earthen_spike.up&talent.earthen_spike.enabled|!talent.earthen_spike.enabled
actions.CDs+=/ascendance,if=buff.doom_winds.up

actions.buffs=rockbiter,if=talent.landslide.enabled&!buff.landslide.up
actions.buffs+=/fury_of_air,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
actions.buffs+=/crash_lightning,if=artifact.alpha_wolf.rank&prev_gcd.1.feral_spirit
actions.buffs+=/flametongue,if=!buff.flametongue.up
actions.buffs+=/frostbrand,if=talent.hailstorm.enabled&!buff.frostbrand.up&variable.furyCheck45
actions.buffs+=/flametongue,if=buff.flametongue.remains<6+gcd&cooldown.doom_winds.remains<gcd*2
actions.buffs+=/frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<6+gcd&cooldown.doom_winds.remains<gcd*2

actions.core=earthen_spike,if=variable.furyCheck25
actions.core+=/crash_lightning,if=!buff.crash_lightning.up&active_enemies>=2
actions.core+=/windsong
actions.core+=/crash_lightning,if=active_enemies>=8|(active_enemies>=6&talent.crashing_storm.enabled)
actions.core+=/windstrike
actions.core+=/stormstrike,if=buff.stormbringer.up&variable.furyCheck25
actions.core+=/crash_lightning,if=active_enemies>=4|(active_enemies>=2&talent.crashing_storm.enabled)
actions.core+=/lightning_bolt,if=talent.overcharge.enabled&variable.furyCheck45&maelstrom>=40
actions.core+=/stormstrike,if=(!talent.overcharge.enabled&variable.furyCheck45)|(talent.overcharge.enabled&variable.furyCheck80)
actions.core+=/frostbrand,if=variable.akainuAS
actions.core+=/lava_lash,if=buff.hot_hand.react&((variable.akainuEquipped&buff.frostbrand.up)|!variable.akainuEquipped)
actions.core+=/sundering,if=active_enemies>=3
actions.core+=/crash_lightning,if=active_enemies>=3|variable.LightningCrashNotUp|variable.alphaWolfCheck

actions.filler=rockbiter,if=maelstrom<120
actions.filler+=/flametongue,if=buff.flametongue.remains<4.8
actions.filler+=/rockbiter,if=maelstrom<=40
actions.filler+=/crash_lightning,if=(talent.crashing_storm.enabled|active_enemies>=2)&debuff.earthen_spike.up&maelstrom>=40&variable.OCPool60
actions.filler+=/frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<4.8&maelstrom>40
actions.filler+=/frostbrand,if=variable.akainuEquipped&!buff.frostbrand.up&maelstrom>=75
actions.filler+=/sundering
actions.filler+=/lava_lash,if=maelstrom>=50&variable.OCPool70&variable.furyCheck80
actions.filler+=/rockbiter
actions.filler+=/crash_lightning,if=(maelstrom>=65|talent.crashing_storm.enabled|active_enemies>=2)&variable.OCPool60&variable.furyCheck45
actions.filler+=/flametongue

actions.opener=rockbiter,if=maelstrom<15&time<2

head=helmet_of_the_skybreaker,id=147178,bonus_id=1512/3563
neck=string_of_extracted_incisors,id=147013,bonus_id=1512/3563,enchant_id=5439
shoulders=pauldrons_of_the_skybreaker,id=147180,bonus_id=1512/3563
back=drape_of_the_skybreaker,id=147176,bonus_id=1512/3563,enchant_id=5435
chest=harness_of_the_skybreaker,id=147175,bonus_id=1512/3563
wrists=painsinged_armguards,id=147057,bonus_id=1512/3563
hands=smoldering_heart,id=151819,bonus_id=3570
waist=waistguard_of_interminable_unity,id=147056,bonus_id=1512/3563
legs=fleshraking_leggings,id=147051,bonus_id=1512/3563
feet=starstalker_treads,id=147046,bonus_id=1522/3563,gem_id=130222
finger1=eye_of_the_twisting_nether,id=137050,bonus_id=3570,gem_id=130247,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,bonus_id=1512/3563,enchant=200haste
trinket1=specter_of_betrayal,id=151190,bonus_id=1522/3563
trinket2=cradle_of_anguish,id=147010,bonus_id=1512/3563
main_hand=doomhammer,id=128819,bonus_id=745,gem_id=147088/147100/147115,relic_id=1512:3563/1512:3563/1512:3563
off_hand=fury_of_the_stonemother,id=128873,gem_id=0/0/0/0,relic_id=0/0

# Gear Summary
# gear_ilvl=938.88
# gear_agility=28018
# gear_stamina=45295
# gear_crit_rating=3439
# gear_haste_rating=13565
# gear_mastery_rating=8916
# gear_versatility_rating=2624
# gear_armor=3282
# set_bonus=tier19_2pc=1

T19 2pc - T20 4pc : 1394926 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1394926.1 1394926.1 2993.7 / 0.215% 293625.5 / 21.0% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.41% 60.6 100.0% 100%
Talents
  • 15: Landslide (Enhancement Shaman)
  • 30: Rainfall (Enhancement Shaman)
  • 45: Voodoo Totem
  • 60: Hailstorm (Enhancement Shaman)
  • 75: Tempest (Enhancement Shaman)
  • 90: Crashing Storm (Enhancement Shaman)
  • 100: Ascendance (Enhancement Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
T19 2pc - T20 4pc 1394926
Crash Lightning 54377 (64312) 3.9% (4.6%) 21.2 14.24sec 909035 857859 Direct 21.2 646464 1233871 767955 20.7% 0.0%  

Stats details: crash_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.21 21.21 0.00 0.00 1.0597 0.0000 16287782.48 16287782.48 0.00 857858.61 857858.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.83 79.33% 646463.56 181928 1265058 658560.21 397989 989772 10876824 10876824 0.00
crit 4.38 20.67% 1233870.56 363856 2530117 1240928.71 0 2530117 5410959 5410959 0.00
 
 

Action details: crash_lightning

Static Values
  • id:187874
  • school:nature
  • resource:maelstrom
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:artifact.alpha_wolf.rank&prev_gcd.1.feral_spirit
Spelldata
  • id:187874
  • name:Crash Lightning
  • school:nature
  • tooltip:Stormstrike and Lava Lash deal an additional $195592sw1 damage to all targets in front of you.
  • description:Electrocutes all enemies in front of you, dealing $sw1 Nature damage. Hitting 2 or more targets enhances your weapons for {$187878d=10 seconds}, causing Stormstrike and Lava Lash to also deal $195592sw1 Nature damage to all targets in front of you.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.50
 
    Crashing Storm 9934 0.7% 146.9 2.00sec 20380 0 Direct 146.9 16494 32978 20380 23.6% 0.0%  

Stats details: crashing_storm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 146.88 146.88 0.00 0.00 0.0000 0.0000 2993447.59 2993447.59 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 112.25 76.42% 16494.10 14519 18094 16503.74 16066 17125 1851493 1851493 0.00
crit 34.63 23.58% 32978.24 29037 36187 32999.61 31839 34565 1141954 1141954 0.00
 
 

Action details: crashing_storm

Static Values
  • id:210801
  • school:nature
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210801
  • name:Crashing Storm
  • school:nature
  • tooltip:
  • description:{$@spelldesc192246=Crash Lightning also electrifies the ground, leaving an electrical field behind which damages enemies within it for ${7*{$210801s1=1}} Nature damage over {$210797d=6 seconds}. }
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.160000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Dread Torrent 40585 2.9% 52.9 10.59sec 230327 0 Direct 52.9 187683 375466 230335 22.7% 0.0%  

Stats details: dread_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.94 52.94 0.00 0.00 0.0000 0.0000 12192643.75 12192643.75 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.92 77.29% 187683.37 182405 187918 187678.66 186714 187918 7679086 7679086 0.00
crit 12.02 22.71% 375466.20 364809 375836 375454.89 371892 375836 4513558 4513558 0.00
 
 

Action details: dread_torrent

Static Values
  • id:246464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246464
  • name:Dread Torrent
  • school:shadow
  • tooltip:
  • description:{$@spelldesc246461=Create a Dread Reflection at your location for {$d=60 seconds} and cause each of your Dread Reflections to unleash a torrent of magic that deals ${{$246464s1=39731 to 43913}*4} Shadow damage over {$246463d=3 seconds}, split evenly among nearby enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:140074.50
  • base_dd_max:154819.18
 
Flametongue 15439 (68401) 1.1% (4.9%) 19.6 15.63sec 1044284 984752 Direct 19.6 192289 384688 236456 23.0% 0.0%  

Stats details: flametongue

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.61 19.61 0.00 0.00 1.0605 0.0000 4636994.45 4636994.45 0.00 984752.34 984752.34
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.11 77.04% 192288.60 179999 210826 192378.02 185049 202205 2904895 2904895 0.00
crit 4.50 22.96% 384688.42 359999 421651 382014.60 0 421651 1732099 1732099 0.00
 
 

Action details: flametongue

Static Values
  • id:193796
  • school:fire
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!buff.flametongue.up
Spelldata
  • id:193796
  • name:Flametongue
  • school:fire
  • tooltip:
  • description:Scorches your target, dealing {$s2=1} Fire damage, and enhances your weapons with fire for {$194084d=16 seconds}, causing each weapon attack to deal up to ${$<coeff>*$AP} Fire damage, based on weapon speed.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Flametongue Attack 52962 3.8% 907.8 0.60sec 17450 0 Direct 907.8 14187 28378 17450 23.0% 0.0%  

Stats details: flametongue_attack

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 907.78 907.78 0.00 0.00 0.0000 0.0000 15840930.53 15840930.53 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 699.06 77.01% 14187.26 12111 15550 14192.60 13879 14637 9917748 9917748 0.00
crit 208.72 22.99% 28378.18 24223 31099 28389.66 27736 29315 5923182 5923182 0.00
 
 

Action details: flametongue_attack

Static Values
  • id:10444
  • school:fire
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:{$@spelldesc193796=Scorches your target, dealing {$s2=1} Fire damage, and enhances your weapons with fire for {$194084d=16 seconds}, causing each weapon attack to deal up to ${$<coeff>*$AP} Fire damage, based on weapon speed.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Frostbrand 9132 (125304) 0.7% (9.0%) 18.8 16.28sec 1995068 1880462 Direct 18.8 118707 237386 145887 22.9% 0.0%  

Stats details: frostbrand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.79 18.79 87.14 0.00 1.0610 3.3005 2741888.08 2741888.08 0.00 121924.11 1880462.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.49 77.10% 118707.33 109360 130010 118769.63 114186 124780 1720102 1720102 0.00
crit 4.30 22.90% 237385.90 222001 260020 235900.75 0 260020 1021786 1021786 0.00
 
 

Action details: frostbrand

Static Values
  • id:196834
  • school:frost
  • resource:maelstrom
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.hailstorm.enabled&!buff.frostbrand.up&variable.furyCheck45
Spelldata
  • id:196834
  • name:Frostbrand
  • school:frost
  • tooltip:Melee attacks reduce target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
  • description:Chills your target, dealing {$s1=1} Frost damage and reducing the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}, and enhances your weapons with frost for {$d=16 seconds}, causing each weapon attack to reduce the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.925000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.00
  • base_tick_time:5.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Hailstorm 116172 8.3% 896.8 0.60sec 38753 0 Direct 896.8 31501 63008 38752 23.0% 0.0%  

Stats details: hailstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 896.83 896.83 0.00 0.00 0.0000 0.0000 34754531.37 34754531.37 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 690.41 76.98% 31500.63 28255 33735 31509.58 30988 32276 21748223 21748223 0.00
crit 206.42 23.02% 63007.71 56510 67470 63025.54 61934 64619 13006308 13006308 0.00
 
 

Action details: hailstorm

Static Values
  • id:210854
  • school:frost
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210854
  • name:Hailstorm
  • school:frost
  • tooltip:
  • description:{$@spelldesc210853=Frostbrand now also enhances your weapon's damage, causing each of your weapon attacks to also deal $210854sw1 Frost damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.30
 
Lava Lash 104261 (115780) 7.5% (8.4%) 38.2 7.45sec 912729 860764 Direct 38.2 663078 1328991 821744 23.8% 0.0%  

Stats details: lava_lash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.18 38.18 0.00 0.00 1.0604 0.0000 31376347.23 31376347.23 0.00 860764.44 860764.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.08 76.17% 663078.34 448188 1478679 670365.39 555508 1031738 19284248 19284248 0.00
crit 9.10 23.83% 1328990.69 896377 2957357 1343277.21 942508 2658109 12092100 12092100 0.00
 
 

Action details: lava_lash

Static Values
  • id:60103
  • school:fire
  • resource:maelstrom
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.hot_hand.react&((variable.akainuEquipped&buff.frostbrand.up)|!variable.akainuEquipped)
Spelldata
  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing $sw1 Fire damage.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:7.81
 
    Doom Vortex (_ll) 11518 0.8% 45.6 5.74sec 76186 0 Direct 45.6 61842 123688 76180 23.2% 0.0%  

Stats details: doom_vortex_ll

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.58 45.58 0.00 0.00 0.0000 0.0000 3472561.71 3472561.71 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.01 76.81% 61841.55 53634 67845 61871.85 58786 67348 2164896 2164896 0.00
crit 10.57 23.19% 123688.42 107269 135691 123545.75 0 135691 1307666 1307666 0.00
 
 

Action details: doom_vortex_ll

Static Values
  • id:199116
  • school:fire
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:199116
  • name:Doom Vortex
  • school:fire
  • tooltip:
  • description:{$@spelldesc199107=Lava Lash{$?s210727=false}[ and Lightning Bolt have][ has] a chance to cause |cFFFFCC99Doomhammer|r to release a fiery tornado at your target's location, dealing ${3*{$199116s1=1}} Fire damage over {$199121d=3 seconds} to enemies within $199116A1 yards.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.600000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
main_hand 19553 1.4% 132.4 2.27sec 44537 28283 Direct 132.4 42783 85588 44535 23.0% 18.9%  

Stats details: main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 132.37 132.37 0.00 0.00 1.5747 0.0000 5895252.60 8666579.73 31.98 28282.87 28282.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.99 58.17% 42783.45 38433 46041 42800.56 41933 43881 3293994 4842484 31.98
crit 30.39 22.96% 85587.96 76867 92082 85621.15 83578 89428 2601258 3824096 31.98
miss 24.98 18.87% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Mark of the Hidden Satyr 21662 1.6% 20.5 14.61sec 316329 0 Direct 20.5 257264 515352 316319 22.9% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.52 20.52 0.00 0.00 0.0000 0.0000 6489867.50 6489867.50 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.82 77.11% 257263.83 223468 282681 257369.99 243620 270206 4070179 4070179 0.00
crit 4.70 22.89% 515352.49 446936 565361 511470.83 0 565361 2419689 2419689 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
offhand 9725 0.7% 131.8 2.27sec 22250 14078 Direct 131.8 21409 42814 22251 22.9% 19.0%  

Stats details: offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 131.77 131.77 0.00 0.00 1.5805 0.0000 2931933.32 4310219.70 31.98 14077.97 14077.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.49 58.05% 21409.28 18933 23021 21418.23 21021 22137 1637618 2407453 31.98
crit 30.23 22.94% 42813.55 38433 46041 42832.42 41717 44292 1294315 1902766 31.98
miss 25.05 19.01% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: offhand

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Rockbiter 100988 7.3% 55.9 5.31sec 543671 508208 Direct 55.9 440307 880946 543654 23.5% 0.0%  

Stats details: rockbiter

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.93 55.93 0.00 0.00 1.0698 0.0000 30406580.29 30406580.29 0.00 508207.79 508207.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.81 76.54% 440306.87 406397 483136 440557.07 430710 455810 18848873 18848873 0.00
crit 13.12 23.46% 880946.16 824986 966273 881306.75 837053 931566 11557707 11557707 0.00
 
 

Action details: rockbiter

Static Values
  • id:193786
  • school:nature
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.landslide.enabled&!buff.landslide.up
Spelldata
  • id:193786
  • name:Rockbiter
  • school:nature
  • tooltip:
  • description:Assaults your target with earthen power, dealing {$s1=0} Nature damage. |cFFFFFFFFGenerates {$s2=25} Maelstrom.|r
 
Stormlash 39489 2.8% 699.7 1.08sec 16915 0 Direct 699.7 16915 0 16915 0.0% 0.0%  

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 699.73 699.73 0.00 0.00 0.0000 0.0000 11836141.34 11836141.34 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 699.73 100.00% 16915.01 2717 105896 16913.97 14682 19207 11836141 11836141 0.00
 
 

Action details: stormlash

Static Values
  • id:213307
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:213307
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:{$@spelldesc195255=While your weapons are enhanced, your attacks have a chance to grant Stormlash to up to {$?s210731=false}[${$m1+$210731m1}][{$s1=2}] party or raid members for {$195222d=8 seconds}, causing attacks and spellcasts to deal additional Nature damage.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:2.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:15986.46
  • base_dd_max:15986.46
 
Stormstrike 0 (264451) 0.0% (19.1%) 73.5 3.75sec 1082357 1003849

Stats details: stormstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.50 0.00 0.00 0.00 1.0782 0.0000 0.00 0.00 0.00 1003848.93 1003848.93
 
 

Action details: stormstrike

Static Values
  • id:17364
  • school:physical
  • resource:maelstrom
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.stormbringer.up&variable.furyCheck25
Spelldata
  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of ${$32175sw1+$32176sw1} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
    Stormstrike (_mh) 176210 12.7% 92.0 3.75sec 576322 0 Direct 92.0 365753 886622 576334 40.4% 0.0%  

Stats details: stormstrike_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.98 91.98 0.00 0.00 0.0000 0.0000 53007296.69 77925747.13 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 54.79 59.57% 365752.66 150336 572971 366455.46 300503 430108 20040690 29461713 31.98
crit 37.18 40.43% 886622.45 300671 1145942 887840.90 763066 1003252 32966607 48464034 31.98
 
 

Action details: stormstrike_mh

Static Values
  • id:32175
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of ${$32175sw1+$32176sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:7.50
 
    Stormstrike Off-Hand 88241 6.4% 92.0 3.75sec 288586 0 Direct 92.0 182626 443780 288570 40.6% 0.0%  

Stats details: stormstrike_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.98 91.98 0.00 0.00 0.0000 0.0000 26542711.96 39020300.78 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 54.66 59.42% 182625.85 75168 286486 182950.67 154420 212302 9981281 14673429 31.98
crit 37.32 40.58% 443779.89 150336 572971 444443.31 380832 507363 16561431 24346872 31.98
 
 

Action details: stormstrike_offhand

Static Values
  • id:32176
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of ${$32175sw1+$32176sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:7.50
 
Unleash Lava 47250 3.4% 127.6 3.18sec 110402 0 Direct 126.0 90883 181782 111733 22.9% 0.0%  

Stats details: unleash_lava

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 127.56 126.04 0.00 0.00 0.0000 0.0000 14082630.68 14082630.68 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 97.13 77.06% 90882.95 78663 99506 90914.04 87793 94689 8827195 8827195 0.00
crit 28.91 22.94% 181782.07 155001 199012 181841.83 173989 190754 5255436 5255436 0.00
 
 

Action details: unleash_lava

Static Values
  • id:199053
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:1.2000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:199053
  • name:Unleash Lava
  • school:fire
  • tooltip:
  • description:{$@spelldesc198736=Stormstrike has a chance to unleash the power of |cFFFFCC99Doomhammer|r, causing your special attacks to heave molten lava or lightning spikes at your target for {$199053s1=1} Fire or Nature damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.800000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Unleash Lightning 47324 3.4% 127.8 3.17sec 110291 0 Direct 126.3 90881 181786 111631 22.8% 0.0%  

Stats details: unleash_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 127.82 126.28 0.00 0.00 0.0000 0.0000 14097209.84 14097209.84 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 97.46 77.17% 90881.38 78663 99506 90915.94 87291 95734 8856898 8856898 0.00
crit 28.83 22.83% 181786.13 157326 199012 181844.37 174536 192496 5240312 5240312 0.00
 
 

Action details: unleash_lightning

Static Values
  • id:199054
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:1.2000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:199054
  • name:Unleash Lightning
  • school:nature
  • tooltip:
  • description:{$@spelldesc198736=Stormstrike has a chance to unleash the power of |cFFFFCC99Doomhammer|r, causing your special attacks to heave molten lava or lightning spikes at your target for {$199053s1=1} Fire or Nature damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.800000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Windlash (wind_lash) 14422 1.0% 54.9 4.97sec 77745 59433 Direct 54.9 63209 126454 77739 23.0% 0.0%  

Stats details: wind_lash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.87 54.87 0.00 0.00 1.3081 0.0000 4266217.72 4266217.72 0.00 59432.97 59432.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.26 77.02% 63208.94 55666 67685 63245.38 60699 66004 2671308 2671308 0.00
crit 12.61 22.98% 126453.53 111331 135370 126509.88 120069 135370 1594909 1594909 0.00
 
 

Action details: wind_lash

Static Values
  • id:114089
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114089
  • name:Windlash
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals $sw1 Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Windlash Off-Hand (wind_lash_offhand) 7212 0.5% 54.9 4.96sec 38826 29721 Direct 54.9 31604 63221 38826 22.8% 0.0%  

Stats details: wind_lash_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.95 54.95 0.00 0.00 1.3064 0.0000 2133371.05 2133371.05 0.00 29720.55 29720.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.39 77.15% 31603.61 27833 33842 31622.02 30280 33123 1339797 1339797 0.00
crit 12.55 22.85% 63220.66 56501 67685 63253.16 59480 67685 793574 793574 0.00
 
 

Action details: wind_lash_offhand

Static Values
  • id:114093
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114093
  • name:Windlash Off-Hand
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals $sw1 Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Windfury Attack 73717 5.3% 183.5 3.32sec 119918 0 Direct 183.5 97351 195775 119922 22.9% 0.0%  

Stats details: windfury_attack

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 183.54 183.54 0.00 0.00 0.0000 0.0000 22009761.22 32356433.81 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 141.45 77.07% 97351.45 55030 200065 97600.23 82127 116975 13770884 20244503 31.98
crit 42.08 22.93% 195774.92 111710 400130 196269.27 138728 259658 8238878 12111931 31.98
 
 

Action details: windfury_attack

Static Values
  • id:25504
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Each of your main hand attacks has a {$33757h=20}% chance to trigger two extra attacks, dealing $25504sw2 Physical damage each.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Windfury Attack (_oh) 14788 1.1% 38.3 14.87sec 115211 0 Direct 38.3 93540 187155 115212 23.1% 0.0%  

Stats details: windfury_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.33 38.33 0.00 0.00 0.0000 0.0000 4416118.99 6492113.22 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.46 76.85% 93539.61 83783 100032 93569.80 90049 97891 2755423 4050733 31.98
crit 8.87 23.15% 187154.94 167566 200065 187214.55 174202 200065 1660696 2441380 31.98
 
 

Action details: windfury_attack_oh

Static Values
  • id:33750
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:33750
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:$@spelldesc8232
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Windstrike 0 (278149) 0.0% (19.7%) 54.7 4.98sec 1500632 1529028

Stats details: windstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.69 0.00 0.00 0.00 0.9814 0.0000 0.00 0.00 0.00 1529028.13 1529028.13
 
 

Action details: windstrike

Static Values
  • id:115356
  • school:physical
  • resource:maelstrom
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(variable.heartEquipped|set_bonus.tier19_2pc)&(!talent.earthen_spike.enabled|(cooldown.earthen_spike.remains>1&cooldown.doom_winds.remains>1)|debuff.earthen_spike.up)
Spelldata
  • id:115356
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:Hurl a staggering blast of wind at an enemy, dealing a total of ${$115357sw1+$115360sw1} Physical damage, bypassing armor.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
    Windstrike (_mh) 185499 13.1% 68.4 4.98sec 799730 0 Direct 68.4 531861 1260849 799877 36.8% 0.0%  

Stats details: windstrike_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 68.43 68.43 0.00 0.00 0.0000 0.0000 54728510.57 54728510.57 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.27 63.24% 531861.34 205945 842322 533409.02 426112 640680 23011034 23011034 0.00
crit 25.16 36.76% 1260849.15 418069 1684644 1263275.27 992163 1544858 31717477 31717477 0.00
 
 

Action details: windstrike_mh

Static Values
  • id:115357
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115357
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of ${$115357sw1+$115360sw1} Physical damage, bypassing armor.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:7.50
 
    Windstrike Off-Hand 92650 6.6% 68.4 4.98sec 399474 0 Direct 68.4 265585 632234 399556 36.5% 0.0%  

Stats details: windstrike_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 68.43 68.43 0.00 0.00 0.0000 0.0000 27337487.24 27337487.24 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.42 63.46% 265585.32 102973 421161 266394.15 216651 320857 11532285 11532285 0.00
crit 25.00 36.54% 632234.40 209035 842322 633618.03 481527 740635 15805202 15805202 0.00
 
 

Action details: windstrike_offhand

Static Values
  • id:115360
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115360
  • name:Windstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of ${$115357sw1+$115360sw1} Physical damage, bypassing armor.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:7.50
 
pet - frost_wolf 322542 / 19773
Frozen Bite 148318 0.7% 8.2 30.16sec 333270 0 Direct 8.2 269020 537633 333235 23.9% 0.0%  

Stats details: frozen_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.19 8.19 0.00 0.00 0.0000 0.0000 2729004.03 2729004.03 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.23 76.08% 269019.70 236633 294910 268123.66 0 294910 1675860 1675860 0.00
crit 1.96 23.92% 537632.90 473265 589819 448275.85 0 589819 1053144 1053144 0.00
 
 

Action details: frozen_bite

Static Values
  • id:224126
  • school:frost
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224126
  • name:Frozen Bite
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Bite the target, causing {$s1=1} Frost damage and slowing the target's movement speed by {$s2=50}% for {$d=4 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
melee 104762 0.5% 47.4 4.63sec 40463 48182 Direct 47.4 32782 65547 40463 23.4% 0.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.42 47.42 0.00 0.00 0.8398 0.0000 1918715.60 2820693.67 31.98 48182.30 48182.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.30 76.55% 32781.98 28640 35693 32747.63 0 35693 1189986 1749392 31.96
crit 11.12 23.45% 65546.58 57279 71386 65378.52 0 71386 728730 1071302 31.90
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Snowstorm 69463 0.3% 14.3 15.28sec 89097 0 Direct 14.3 72172 144226 89099 23.5% 0.0%  

Stats details: snowstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.33 14.33 0.00 0.00 0.0000 0.0000 1277197.06 1277197.06 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.97 76.50% 72171.65 63102 78642 71662.27 0 78642 791469 791469 0.00
crit 3.37 23.50% 144225.66 126203 157284 132858.14 0 157284 485728 485728 0.00
 
 

Action details: snowstorm

Static Values
  • id:198483
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198483
  • name:Snowstorm
  • school:frost
  • tooltip:
  • description:Deals {$s1=0} Frost damage to all targets within $A1 yards.
 
pet - fiery_wolf 397410 / 24387
Fiery Jaws 224025 1.0% 8.1 29.95sec 505535 0 Direct 8.1 179125 358655 221696 23.7% 0.0%  
Periodic 32.0 71831 0 71831 0.0% 0.0% 10.7%

Stats details: fiery_jaws

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.10 8.10 31.99 31.99 0.0000 1.0000 4092999.31 4092999.31 0.00 127946.21 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.18 76.28% 179124.97 157756 196607 178513.78 0 196607 1106223 1106223 0.00
crit 1.92 23.72% 358655.33 315511 393214 294543.06 0 393214 688846 688846 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.0 100.00% 71831.00 63103 78644 71751.83 0 78644 2297931 2297931 0.00
 
 

Action details: fiery_jaws

Static Values
  • id:224125
  • school:fire
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224125
  • name:Fiery Jaws
  • school:fire
  • tooltip:Suffering {$s2=1} Fire damage every $t sec.
  • description:Bite the target for {$s1=1} Fire damage, causing an additional $o2 Fire damage over {$d=4 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.400000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Fire Nova 69049 0.3% 14.1 15.13sec 89069 0 Direct 14.1 72082 144178 89061 23.6% 0.0%  

Stats details: fire_nova

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.09 14.09 0.00 0.00 0.0000 0.0000 1254893.76 1254893.76 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.77 76.44% 72081.91 63102 78642 71856.93 0 78642 776261 776261 0.00
crit 3.32 23.56% 144178.28 126203 157284 133214.90 0 157284 478633 478633 0.00
 
 

Action details: fire_nova

Static Values
  • id:198480
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198480
  • name:Fire Nova
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to all targets within $A1 yards.
 
melee 104337 0.5% 47.0 4.58sec 40385 48128 Direct 47.0 32749 65505 40384 23.3% 0.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.95 46.95 0.00 0.00 0.8391 0.0000 1896210.43 2787608.94 31.98 48128.39 48128.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.01 76.69% 32748.91 28640 35693 32706.07 30167 35693 1179156 1733470 31.98
crit 10.95 23.31% 65504.74 57279 71386 65251.21 0 71386 717055 1054138 31.89
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lightning_wolf 238448 / 15205
melee 141159 0.6% 47.9 4.65sec 56189 66714 Direct 47.9 45591 91320 56185 23.2% 0.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.86 47.86 0.00 0.00 0.8422 0.0000 2688989.96 3953069.95 31.98 66714.38 66714.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.77 76.82% 45590.55 28640 53539 45511.61 30931 51358 1676130 2464070 31.98
crit 11.09 23.18% 91320.12 57279 107079 90603.21 0 107079 1012860 1489000 31.76
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Thunder Bite 97289 0.4% 14.4 15.53sec 129190 0 Direct 14.4 104269 208985 129182 23.8% 0.0%  

Stats details: thunder_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.36 14.36 0.00 0.00 0.0000 0.0000 1854624.81 1854624.81 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.94 76.21% 104269.23 63102 117963 103861.99 0 117963 1140771 1140771 0.00
crit 3.42 23.79% 208984.87 126203 235926 194868.67 0 235926 713854 713854 0.00
 
 

Action details: thunder_bite

Static Values
  • id:198485
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198485
  • name:Thunder Bite
  • school:nature
  • tooltip:
  • description:Deals {$s1=0} Nature damage, jumping to up to $x targets.
 
Simple Action Stats Execute Interval
T19 2pc - T20 4pc
Ascendance 2.0 185.06sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.04 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114051
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.doom_winds.up
Spelldata
  • id:114051
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a $114089r yard range. Stormstrike is empowered and has a $114089r yard range.
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, reducing the cooldown and cost of Stormstrike by {$s4=80}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$s1=30} yd range.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T19 2pc - T20 4pc
  • harmful:false
  • if_expr:
 
Berserking 2.0 189.61sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.03 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ascendance.up|(feral_spirit.remains>5)|level<100
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Doom Winds 5.3 61.67sec

Stats details: doom_winds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.34 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: doom_winds

Static Values
  • id:204945
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:debuff.earthen_spike.up&talent.earthen_spike.enabled|!talent.earthen_spike.enabled
Spelldata
  • id:204945
  • name:Doom Winds
  • school:physical
  • tooltip:Chance to proc Windfury weapon on auto attacks increased by 100%. Windfury damage increased by {$s2=200}%.
  • description:Unleashes the inner power of the |cFFFFCC99Doomhammer|r, causing all auto attacks to trigger Windfury, and increasing damage dealt by Windfury by {$s2=200}% for {$d=6 seconds}.
 
Feral Spirit 3.0 121.12sec

Stats details: feral_spirit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 0.00 0.00 1.0192 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: feral_spirit

Static Values
  • id:51533
  • school:nature
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects$?a231723[ and grant you {$190185s1=5} Maelstrom each time they attack][].
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T19 2pc - T20 4pc
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T19 2pc - T20 4pc
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
pet - lightning_wolf
Crackling Surge 8.3 30.56sec

Stats details: crackling_surge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.32 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: crackling_surge

Static Values
  • id:224127
  • school:nature
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224127
  • name:Crackling Surge
  • school:nature
  • tooltip:Damage dealt increased by {$s1=50}%.
  • description:The Doom Wolf surges with electric energy, increasing all damage dealt by {$s1=50}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 6.4 0.1 47.6sec 46.4sec 27.64% 87.82% 0.1(0.1) 6.1

Buff details

  • buff initial source:T19 2pc - T20 4pc
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:27.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114051
  • name:Ascendance
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a $114089r yard range. Stormstrike is empowered and has a $114089r yard range.
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, reducing the cooldown and cost of Stormstrike by {$s4=80}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$s1=30} yd range.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Berserking 2.0 0.0 190.1sec 190.1sec 6.81% 11.70% 0.0(0.0) 2.0

Buff details

  • buff initial source:T19 2pc - T20 4pc
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.59% 13.59% 0.0(0.0) 1.0

Buff details

  • buff initial source:T19 2pc - T20 4pc
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Chill of the Twisting Nether 1.1 930.3 157.0sec 0.3sec 99.26% 99.35% 930.3(930.3) 0.1

Buff details

  • buff initial source:T19 2pc - T20 4pc
  • cooldown name:buff_chill_of_the_twisting_nether
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02

Stack Uptimes

  • chill_of_the_twisting_nether_1:99.26%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:207998
  • name:Chill of the Twisting Nether
  • tooltip:All damage done increased by ${{$s1=15}/10}.1%.
  • description:{$@spelldesc207994=Damaging enemies with your Fire, Frost, or Nature abilities increases all damage you deal by ${{$207995s1=15}/10}.1% for {$207995d=8 seconds}. Each element adds a separate application.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.2 35.4sec 24.8sec 32.32% 32.32% 3.2(3.2) 8.0

Buff details

  • buff initial source:T19 2pc - T20 4pc
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Crashing Lightning 19.2 141.3 15.8sec 1.8sec 76.29% 87.01% 11.5(11.5) 0.0

Buff details

  • buff initial source:T19 2pc - T20 4pc
  • cooldown name:buff_crashing_lightning
  • max_stacks:15
  • duration:16.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.35

Stack Uptimes

  • crashing_lightning_1:9.40%
  • crashing_lightning_2:10.06%
  • crashing_lightning_3:8.29%
  • crashing_lightning_4:7.50%
  • crashing_lightning_5:6.60%
  • crashing_lightning_6:5.77%
  • crashing_lightning_7:5.00%
  • crashing_lightning_8:4.36%
  • crashing_lightning_9:3.62%
  • crashing_lightning_10:3.04%
  • crashing_lightning_11:2.48%
  • crashing_lightning_12:2.01%
  • crashing_lightning_13:1.62%
  • crashing_lightning_14:1.30%
  • crashing_lightning_15:5.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242286
  • name:Crashing Lightning
  • tooltip:Damage done by your next Crash Lightning increased by {$s1=35}%.
  • description:{$@spelldesc242285=Stormstrike increases the initial damage of your next Crash Lightning by {$242286s1=35}%, stacking up to {$242286u=15} times.}
  • max_stacks:15
  • duration:16.00
  • cooldown:0.00
  • default_chance:101.00%
Doom Winds 5.3 0.0 61.7sec 61.7sec 10.51% 19.06% 0.0(0.0) 5.2

Buff details

  • buff initial source:T19 2pc - T20 4pc
  • cooldown name:buff_doom_winds
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • doom_winds_1:10.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:204945
  • name:Doom Winds
  • tooltip:Chance to proc Windfury weapon on auto attacks increased by 100%. Windfury damage increased by {$s2=200}%.
  • description:Unleashes the inner power of the |cFFFFCC99Doomhammer|r, causing all auto attacks to trigger Windfury, and increasing damage dealt by Windfury by {$s2=200}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:60.00
  • default_chance:0.00%
Fire of the Twisting Nether 1.0 1130.4 229.3sec 0.3sec 99.62% 99.70% 1130.4(1130.4) 0.0

Buff details

  • buff initial source:T19 2pc - T20 4pc
  • cooldown name:buff_fire_of_the_twisting_nether
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02

Stack Uptimes

  • fire_of_the_twisting_nether_1:99.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:207995
  • name:Fire of the Twisting Nether
  • tooltip:All damage done increased by ${{$s1=15}/10}.1%.
  • description:{$@spelldesc207994=Damaging enemies with your Fire, Frost, or Nature abilities increases all damage you deal by ${{$207995s1=15}/10}.1% for {$207995d=8 seconds}. Each element adds a separate application.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Flametongue 6.0 13.6 50.7sec 15.6sec 97.85% 97.97% 31.4(31.4) 5.0

Buff details

  • buff initial source:T19 2pc - T20 4pc
  • cooldown name:buff_flametongue
  • max_stacks:1
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • flametongue_1:97.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194084
  • name:Flametongue
  • tooltip:Each of your weapon attacks causes up to ${$<coeff>*$AP} additional Fire damage.
  • description:{$@spelldesc193796=Scorches your target, dealing {$s2=1} Fire damage, and enhances your weapons with fire for {$194084d=16 seconds}, causing each weapon attack to deal up to ${$<coeff>*$AP} Fire damage, based on weapon speed.}
  • max_stacks:0
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
Frostbrand 8.2 10.6 37.3sec 16.3sec 96.30% 96.63% 47.1(47.1) 7.2

Buff details

  • buff initial source:T19 2pc - T20 4pc
  • cooldown name:buff_frostbrand
  • max_stacks:1
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • frostbrand_1:96.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196834
  • name:Frostbrand
  • tooltip:Melee attacks reduce target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
  • description:Chills your target, dealing {$s1=1} Frost damage and reducing the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}, and enhances your weapons with frost for {$d=16 seconds}, causing each weapon attack to reduce the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
  • max_stacks:0
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
Gathering Storms 19.3 1.9 15.7sec 14.3sec 22.47% 14.99% 1.9(1.9) 0.0

Buff details

  • buff initial source:T19 2pc - T20 4pc
  • cooldown name:buff_gathering_storms
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • gathering_storms_1:22.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:198300
  • name:Gathering Storms
  • tooltip:Damage of Stormstrike increased by $w1%.
  • description:{$@spelldesc198299=Each target hit by Crash Lightning increases damage dealt by your next Stormstrike within {$198300d=12 seconds} by {$s1=2}%.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Landslide 8.7 47.2 34.1sec 5.3sec 95.58% 88.83% 47.2(47.2) 7.8

Buff details

  • buff initial source:T19 2pc - T20 4pc
  • cooldown name:buff_landslide
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • landslide_1:95.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202004
  • name:Landslide
  • tooltip:Agility increased by {$s1=8}%.
  • description:{$@spelldesc197992=$?s201897[Boulderfist][Rockbiter] enhances your weapon, increasing your Agility by {$202004s1=8}% for {$202004d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Lightning Crash 13.1 8.2 23.4sec 14.3sec 87.59% 51.46% 8.2(8.2) 12.2

Buff details

  • buff initial source:T19 2pc - T20 4pc
  • cooldown name:buff_lightning_crash
  • max_stacks:1
  • duration:16.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.05

Stack Uptimes

  • lightning_crash_1:87.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242284
  • name:Lightning Crash
  • tooltip:Critical strike chance increased by {$s1=5}%.
  • description:{$@spelldesc242283=Crash Lightning increases your critical strike chance by {$242284s1=5}% for {$242284d=16 seconds}.}
  • max_stacks:0
  • duration:16.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 105.8sec 0.0sec 40.07% 40.07% 0.0(0.0) 2.0

Buff details

  • buff initial source:T19 2pc - T20 4pc
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:40.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Shock of the Twisting Nether 2.0 213.1 123.3sec 1.4sec 99.35% 99.27% 213.1(213.1) 1.0

Buff details

  • buff initial source:T19 2pc - T20 4pc
  • cooldown name:buff_shock_of_the_twisting_nether
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02

Stack Uptimes

  • shock_of_the_twisting_nether_1:99.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:207999
  • name:Shock of the Twisting Nether
  • tooltip:All damage done increased by ${{$s1=15}/10}.1%.
  • description:{$@spelldesc207994=Damaging enemies with your Fire, Frost, or Nature abilities increases all damage you deal by ${{$207995s1=15}/10}.1% for {$207995d=8 seconds}. Each element adds a separate application.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 64.1 7.1 4.6sec 4.2sec 20.60% 49.83% 11.0(11.5) 0.0

Buff details

  • buff initial source:T19 2pc - T20 4pc
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormbringer_1:20.60%

Trigger Attempt Success

  • trigger_pct:94.11%

Spelldata details

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike has no cooldown and its cost is reduced by {$s3=50}%.
  • description:{$@spelldesc201845=Your weapon attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike, and cause your next Stormstrike to cost {$201846s3=50}% less Maelstrom and trigger no cooldown.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Stormlash 14.1 10.5 21.6sec 12.1sec 50.36% 50.36% 10.5(10.5) 13.6

Buff details

  • buff initial source:T19 2pc - T20 4pc
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormlash_1:50.36%

Trigger Attempt Success

  • trigger_pct:99.85%

Spelldata details

  • id:195222
  • name:Stormlash
  • tooltip:Empowered with lightning. Attacks and spellcasts have a chance to deal additional Nature damage.
  • description:{$@spelldesc195255=While your weapons are enhanced, your attacks have a chance to grant Stormlash to up to {$?s210731=false}[${$m1+$210731m1}][{$s1=2}] party or raid members for {$195222d=8 seconds}, causing attacks and spellcasts to deal additional Nature damage.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Unleash Doom 15.7 16.3 19.0sec 9.1sec 44.69% 50.84% 16.3(16.3) 15.2

Buff details

  • buff initial source:T19 2pc - T20 4pc
  • cooldown name:buff_unleash_doom
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-0.00

Stack Uptimes

  • unleash_doom_1:44.69%

Trigger Attempt Success

  • trigger_pct:20.00%

Spelldata details

  • id:199055
  • name:Unleash Doom
  • tooltip:Your special attacks will trigger an arc of fiery or lightning damage at your target.
  • description:{$@spelldesc198736=Stormstrike has a chance to unleash the power of |cFFFFCC99Doomhammer|r, causing your special attacks to heave molten lava or lightning spikes at your target for {$199053s1=1} Fire or Nature damage.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Wind Strikes 16.4 54.8 18.5sec 4.2sec 71.10% 78.65% 55.4(59.2) 15.6

Buff details

  • buff initial source:T19 2pc - T20 4pc
  • cooldown name:buff_wind_strikes
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.85

Stack Uptimes

  • wind_strikes_1:71.10%

Trigger Attempt Success

  • trigger_pct:94.12%

Spelldata details

  • id:198293
  • name:Wind Strikes
  • tooltip:Attack speed increased by $w1%.
  • description:{$@spelldesc198292=When Stormbringer resets the remaining cooldown on Stormstrike, you gain {$s1=3}% attack speed for {$198293d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
fiery_wolf: Alpha Wolf 1.6 0.5 97.6sec 55.0sec 73.11% 73.11% 7.5(7.5) 0.7

Buff details

  • buff initial source:T19 2pc - T20 4pc_fiery_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:73.11%

Trigger Attempt Success

  • trigger_pct:99.04%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
fiery_wolf: Alpha Wolf 1.6 0.8 108.9sec 47.2sec 75.55% 75.55% 8.2(8.2) 0.6

Buff details

  • buff initial source:T19 2pc - T20 4pc_fiery_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:75.55%

Trigger Attempt Success

  • trigger_pct:98.65%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
frost_wolf: Alpha Wolf 1.6 0.6 98.4sec 53.6sec 73.98% 73.98% 7.6(7.6) 0.7

Buff details

  • buff initial source:T19 2pc - T20 4pc_frost_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:73.98%

Trigger Attempt Success

  • trigger_pct:98.91%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
frost_wolf: Alpha Wolf 1.6 0.9 108.5sec 47.8sec 75.89% 75.89% 8.3(8.3) 0.6

Buff details

  • buff initial source:T19 2pc - T20 4pc_frost_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:75.89%

Trigger Attempt Success

  • trigger_pct:98.78%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Alpha Wolf 1.7 0.6 103.5sec 59.0sec 73.42% 73.42% 7.9(7.9) 0.8

Buff details

  • buff initial source:T19 2pc - T20 4pc_lightning_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:73.42%

Trigger Attempt Success

  • trigger_pct:99.09%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Alpha Wolf 1.6 0.8 105.9sec 45.8sec 75.67% 75.67% 8.0(8.0) 0.6

Buff details

  • buff initial source:T19 2pc - T20 4pc_lightning_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:75.67%

Trigger Attempt Success

  • trigger_pct:98.67%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Crackling Surge 4.3 0.0 25.2sec 25.2sec 76.03% 71.16% 0.0(0.0) 2.8

Buff details

  • buff initial source:T19 2pc - T20 4pc_lightning_wolf
  • cooldown name:buff_crackling_surge
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • crackling_surge_1:76.03%

Trigger Attempt Success

  • trigger_pct:99.77%

Spelldata details

  • id:224127
  • name:Crackling Surge
  • tooltip:Damage dealt increased by {$s1=50}%.
  • description:The Doom Wolf surges with electric energy, increasing all damage dealt by {$s1=50}%.
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Crackling Surge 4.1 0.0 22.5sec 22.5sec 75.96% 70.88% 0.0(0.0) 2.7

Buff details

  • buff initial source:T19 2pc - T20 4pc_lightning_wolf
  • cooldown name:buff_crackling_surge
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • crackling_surge_1:75.96%

Trigger Attempt Success

  • trigger_pct:99.65%

Spelldata details

  • id:224127
  • name:Crackling Surge
  • tooltip:Damage dealt increased by {$s1=50}%.
  • description:The Doom Wolf surges with electric energy, increasing all damage dealt by {$s1=50}%.
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:T19 2pc - T20 4pc
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:T19 2pc - T20 4pc
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:T19 2pc - T20 4pc
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201639
  • name:Well Fed
  • tooltip:Agility increased by $w1.
  • description:Agility increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Strength of Will

Buff details

  • buff initial source:T19 2pc - T20 4pc
  • cooldown name:buff_strength_of_will
  • max_stacks:10
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:304.77

Stack Uptimes

  • strength_of_will_10:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242642
  • name:Strength of Will
  • tooltip:Strength or Agility increased by {$s3=95}, based on your specialization.
  • description:{$@spelldesc242640=While you are above {$s1=80}% health you gain {$242642s3=95} Strength or Agility per second, based on your specialization, stacking up to {$242642u=10} times. If you fall below {$s2=50}% health, this effect is lost.}
  • max_stacks:10
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
Flametongue: Windfury Attack 218.7 2.8sec
Frostbrand: Windfury Attack 216.5 2.8sec
Maelstrom Weapon: Windfury Attack 221.9 2.7sec
Stormbringer: Windfury Attack 13.7 21.6sec
Stormbringer: Windfury Attack Off-Hand 2.8 74.2sec
Flametongue: main_hand 105.5 2.8sec
Frostbrand: main_hand 103.7 2.8sec
Maelstrom Weapon: main_hand 107.4 2.8sec
Stormbringer: main_hand 8.0 31.5sec
Windfury: main_hand 30.4 9.4sec
Flametongue: Windlash 52.9 5.1sec
Frostbrand: Windlash 51.6 5.2sec
Maelstrom Weapon: Windlash 54.9 4.9sec
Stormbringer: Windlash 4.0 52.3sec
Windfury: Windlash 20.8 12.9sec
Flametongue: offhand 104.8 2.8sec
Frostbrand: offhand 103.9 2.9sec
Maelstrom Weapon: offhand 106.7 2.8sec
Stormbringer: offhand 7.9 31.8sec
Windfury: offhand 8.1 25.5sec
Flametongue: Windlash Off-Hand 52.9 5.1sec
Frostbrand: Windlash Off-Hand 51.6 5.2sec
Maelstrom Weapon: Windlash Off-Hand 54.9 4.9sec
Stormbringer: Windlash Off-Hand 4.1 52.9sec
Windfury: Windlash Off-Hand 11.0 21.4sec
Flametongue: Windstrike 65.3 5.2sec
Frostbrand: Windstrike 63.6 5.3sec
Stormbringer: Windstrike 5.1 44.5sec
Windfury: Windstrike 15.3 18.4sec
Unleash Doom (damage): Windstrike 46.8 7.0sec
Flametongue: Windstrike Off-Hand 65.3 5.2sec
Frostbrand: Windstrike Off-Hand 63.6 5.3sec
Stormbringer: Windstrike Off-Hand 5.1 45.2sec
Unleash Doom (damage): Windstrike Off-Hand 46.8 7.0sec
Stormbringer: Rockbiter 4.1 53.3sec
Unleash Doom (damage): Rockbiter 23.6 12.0sec
Flametongue: Crash Lightning 21.2 14.3sec
Frostbrand: Crash Lightning 21.2 14.3sec
Stormbringer: Crash Lightning 1.6 86.2sec
Windfury: Crash Lightning 4.8 50.6sec
Unleash Doom (damage): Crash Lightning 8.5 33.3sec
Stormbringer: Flametongue 1.4 89.1sec
Unleash Doom (damage): Flametongue 8.4 33.6sec
Stormbringer: Frostbrand 1.4 88.7sec
Unleash Doom (damage): Frostbrand 7.8 35.5sec
Flametongue: Stormstrike 92.0 3.8sec
Frostbrand: Stormstrike 92.0 3.8sec
Stormbringer: Stormstrike 6.8 34.6sec
Windfury: Stormstrike 20.6 13.7sec
Unleash Doom (damage): Stormstrike 51.5 6.5sec
Flametongue: Stormstrike Off-Hand 92.0 3.8sec
Frostbrand: Stormstrike Off-Hand 92.0 3.8sec
Stormbringer: Stormstrike Off-Hand 6.9 34.0sec
Unleash Doom (damage): Stormstrike Off-Hand 51.5 6.5sec
Flametongue: Lava Lash 38.2 7.4sec
Frostbrand: Lava Lash 38.2 7.4sec
Stormbringer: Lava Lash 2.8 66.2sec
Unleash Doom (damage): Lava Lash 11.0 24.0sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Windstrike0.7800.0017.73944.7239.22894.449
Feral Spirit1.2580.00125.6662.2780.00025.672
Doom Winds1.7580.00130.0817.4230.87634.993
Ascendance5.2350.33034.9935.4540.33034.993
Rockbiter3.6020.00121.01164.01421.404117.215
Crash Lightning10.3060.00164.136203.318135.823274.827
Flametongue7.2640.00136.330134.11285.909182.843
Stormstrike1.3890.00111.734112.94133.103206.445

Resources

Resource Usage Type Count Total Average RPE APR
T19 2pc - T20 4pc
crash_lightning Maelstrom 39.3 786.1 20.0 37.1 24526.5
frostbrand Maelstrom 34.8 696.6 20.0 37.1 53826.2
lava_lash Maelstrom 70.8 2122.9 30.0 55.6 16415.7
stormstrike Maelstrom 170.4 3948.8 23.2 53.7 20145.3
windstrike Maelstrom 126.8 636.3 5.0 11.6 128970.3
Resource Gains Type Count Total Average Overflow
Windfury Attack Maelstrom 411.17 2261.57 (27.07%) 5.50 616.62 21.42%
Main Hand Maelstrom 199.00 961.42 (11.51%) 4.83 33.58 3.38%
Windlash Maelstrom 101.70 385.20 (4.61%) 3.79 123.30 24.25%
Off-Hand Maelstrom 197.78 952.74 (11.40%) 4.82 36.17 3.66%
Windlash Off-Hand Maelstrom 101.83 381.23 (4.56%) 3.74 127.93 25.12%
Feral Spirit Maelstrom 185.64 603.12 (7.22%) 3.25 325.11 35.02%
Rockbiter Maelstrom 103.64 2809.19 (33.63%) 27.10 196.44 6.54%
Resource RPS-Gain RPS-Loss
Maelstrom 15.01 14.72
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 88.45 0.00 150.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data T19 2pc - T20 4pc Fight Length
Count 2497
Mean 300.31
Minimum 200.79
Maximum 402.09
Spread ( max - min ) 201.30
Range [ ( max - min ) / 2 * 100% ] 33.52%
Standard Deviation 42.2149
5th Percentile 234.76
95th Percentile 370.50
( 95th Percentile - 5th Percentile ) 135.74
Mean Distribution
Standard Deviation 0.8448
95.00% Confidence Intervall ( 298.65 - 301.96 )
Normalized 95.00% Confidence Intervall ( 99.45% - 100.55% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 760
0.1% Error 75911
0.1 Scale Factor Error with Delta=300 16
0.05 Scale Factor Error with Delta=300 61
0.01 Scale Factor Error with Delta=300 1522
DPS
Sample Data T19 2pc - T20 4pc Damage Per Second
Count 2497
Mean 1394926.15
Minimum 1158879.50
Maximum 1723095.41
Spread ( max - min ) 564215.91
Range [ ( max - min ) / 2 * 100% ] 20.22%
Standard Deviation 76326.3212
5th Percentile 1276336.14
95th Percentile 1523569.80
( 95th Percentile - 5th Percentile ) 247233.66
Mean Distribution
Standard Deviation 1527.4432
95.00% Confidence Intervall ( 1391932.41 - 1397919.88 )
Normalized 95.00% Confidence Intervall ( 99.79% - 100.21% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 116
0.1% Error 11502
0.1 Scale Factor Error with Delta=300 49731589
0.05 Scale Factor Error with Delta=300 198926354
0.01 Scale Factor Error with Delta=300 4973158836
Priority Target DPS
Sample Data T19 2pc - T20 4pc Priority Target Damage Per Second
Count 2497
Mean 1394933.59
Minimum 1176445.39
Maximum 1687083.56
Spread ( max - min ) 510638.17
Range [ ( max - min ) / 2 * 100% ] 18.30%
Standard Deviation 74857.3934
5th Percentile 1277992.16
95th Percentile 1520150.13
( 95th Percentile - 5th Percentile ) 242157.97
Mean Distribution
Standard Deviation 1498.0470
95.00% Confidence Intervall ( 1391997.48 - 1397869.71 )
Normalized 95.00% Confidence Intervall ( 99.79% - 100.21% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 111
0.1% Error 11063
0.1 Scale Factor Error with Delta=300 47835804
0.05 Scale Factor Error with Delta=300 191343213
0.01 Scale Factor Error with Delta=300 4783580310
DPS(e)
Sample Data T19 2pc - T20 4pc Damage Per Second (Effective)
Count 2497
Mean 1394926.15
Minimum 1158879.50
Maximum 1723095.41
Spread ( max - min ) 564215.91
Range [ ( max - min ) / 2 * 100% ] 20.22%
Damage
Sample Data T19 2pc - T20 4pc Damage
Count 2497
Mean 404478218.20
Minimum 321620578.69
Maximum 488049851.49
Spread ( max - min ) 166429272.79
Range [ ( max - min ) / 2 * 100% ] 20.57%
DTPS
Sample Data T19 2pc - T20 4pc Damage Taken Per Second
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data T19 2pc - T20 4pc Healing Per Second
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data T19 2pc - T20 4pc Healing Per Second (Effective)
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data T19 2pc - T20 4pc Heal
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data T19 2pc - T20 4pc Healing Taken Per Second
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data T19 2pc - T20 4pc Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data T19 2pc - T20 4pcTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data T19 2pc - T20 4pc Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 potion
5 0.00 lightning_shield
Default action list Executed every time the actor is available.
# count action,conditions
0.00 wind_shear
0.00 variable,name=hailstormCheck,value=((talent.hailstorm.enabled&!buff.frostbrand.up)|!talent.hailstorm.enabled)
0.00 variable,name=furyCheck80,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>80))
0.00 variable,name=furyCheck70,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>70))
0.00 variable,name=furyCheck45,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>45))
0.00 variable,name=furyCheck25,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>25))
0.00 variable,name=OCPool70,value=(!talent.overcharge.enabled|(talent.overcharge.enabled&maelstrom>70))
0.00 variable,name=OCPool60,value=(!talent.overcharge.enabled|(talent.overcharge.enabled&maelstrom>60))
0.00 variable,name=heartEquipped,value=(equipped.151819)
0.00 variable,name=akainuEquipped,value=(equipped.137084)
0.00 variable,name=akainuAS,value=(variable.akainuEquipped&buff.hot_hand.react&!buff.frostbrand.up)
0.00 variable,name=LightningCrashNotUp,value=(!buff.lightning_crash.up&set_bonus.tier20_2pc)
0.00 variable,name=alphaWolfCheck,value=((pet.frost_wolf.buff.alpha_wolf.remains<2&pet.fiery_wolf.buff.alpha_wolf.remains<2&pet.lightning_wolf.buff.alpha_wolf.remains<2)&feral_spirit.remains>4)
6 1.00 auto_attack
7 7.16 use_items
8 0.00 call_action_list,name=opener
9 54.69 windstrike,if=(variable.heartEquipped|set_bonus.tier19_2pc)&(!talent.earthen_spike.enabled|(cooldown.earthen_spike.remains>1&cooldown.doom_winds.remains>1)|debuff.earthen_spike.up)
A 0.00 call_action_list,name=buffs
B 0.00 call_action_list,name=CDs
C 0.00 call_action_list,name=core
D 0.00 call_action_list,name=filler
actions.CDs
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
E 2.03 berserking,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
0.00 blood_fury,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
F 1.00 potion,if=buff.ascendance.up|!talent.ascendance.enabled&feral_spirit.remains>5|target.time_to_die<=60
G 2.98 feral_spirit
H 5.34 doom_winds,if=debuff.earthen_spike.up&talent.earthen_spike.enabled|!talent.earthen_spike.enabled
I 2.04 ascendance,if=buff.doom_winds.up
actions.buffs
# count action,conditions
J 7.90 rockbiter,if=talent.landslide.enabled&!buff.landslide.up
0.00 fury_of_air,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
K 2.50 crash_lightning,if=artifact.alpha_wolf.rank&prev_gcd.1.feral_spirit
L 6.00 flametongue,if=!buff.flametongue.up
M 8.16 frostbrand,if=talent.hailstorm.enabled&!buff.frostbrand.up&variable.furyCheck45
N 2.43 flametongue,if=buff.flametongue.remains<6+gcd&cooldown.doom_winds.remains<gcd*2
O 2.65 frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<6+gcd&cooldown.doom_winds.remains<gcd*2
actions.core
# count action,conditions
0.00 earthen_spike,if=variable.furyCheck25
0.00 crash_lightning,if=!buff.crash_lightning.up&active_enemies>=2
0.00 windsong
0.00 crash_lightning,if=active_enemies>=8|(active_enemies>=6&talent.crashing_storm.enabled)
0.00 windstrike
P 40.43 stormstrike,if=buff.stormbringer.up&variable.furyCheck25
0.00 crash_lightning,if=active_enemies>=4|(active_enemies>=2&talent.crashing_storm.enabled)
0.00 lightning_bolt,if=talent.overcharge.enabled&variable.furyCheck45&maelstrom>=40
Q 33.06 stormstrike,if=(!talent.overcharge.enabled&variable.furyCheck45)|(talent.overcharge.enabled&variable.furyCheck80)
0.00 frostbrand,if=variable.akainuAS
0.00 lava_lash,if=buff.hot_hand.react&((variable.akainuEquipped&buff.frostbrand.up)|!variable.akainuEquipped)
0.00 sundering,if=active_enemies>=3
R 13.94 crash_lightning,if=active_enemies>=3|variable.LightningCrashNotUp|variable.alphaWolfCheck
actions.filler
# count action,conditions
S 47.21 rockbiter,if=maelstrom<120
T 9.28 flametongue,if=buff.flametongue.remains<4.8
0.00 rockbiter,if=maelstrom<=40
0.00 crash_lightning,if=(talent.crashing_storm.enabled|active_enemies>=2)&debuff.earthen_spike.up&maelstrom>=40&variable.OCPool60
U 7.99 frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<4.8&maelstrom>40
0.00 frostbrand,if=variable.akainuEquipped&!buff.frostbrand.up&maelstrom>=75
0.00 sundering
V 38.18 lava_lash,if=maelstrom>=50&variable.OCPool70&variable.furyCheck80
0.00 rockbiter
W 4.76 crash_lightning,if=(maelstrom>=65|talent.crashing_storm.enabled|active_enemies>=2)&variable.OCPool60&variable.furyCheck45
X 1.90 flametongue
actions.opener
# count action,conditions
Y 0.81 rockbiter,if=maelstrom<15&time<2

Sample Sequence

012467JLMGKEHI99999999999999J9T9M9PQRSVPPPQSSTUVSVVSQVW99S999979SPQLSMVRSV99VQSNOHSVVVSPPPQRPQSSTUVSVVSQP7QRSTVPQSUSVPQSVWXSVUVSQVPPSQWSNOGKHPPQPPJQ7PQVSTUVRSVVQSSVVSVTUSQRVSVVVPQSVSTUVSRQS7WXVSVOWHI9999EFS99999T9V9UJQRSPQSVSVPQSTPPPQMP7SPPRSPQSSLUPQSVPQSGKNOHPPQRVJVVVSVVPPQSLSM7PQRSSVVVST9QSUVVSRVP

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask T19 2pc - T20 4pc 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom
Pre precombat 1 food T19 2pc - T20 4pc 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom
Pre precombat 2 augmentation T19 2pc - T20 4pc 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom potion_of_prolonged_power
0:00.000 default 6 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom potion_of_prolonged_power
0:00.000 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/150: 3% maelstrom potion_of_prolonged_power
0:00.000 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/150: 13% maelstrom potion_of_prolonged_power
0:01.104 buffs L flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/150: 32% maelstrom bloodlust, landslide, shock_of_the_twisting_nether, potion_of_prolonged_power
0:01.955 buffs M frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/150: 45% maelstrom bloodlust, flametongue, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, potion_of_prolonged_power
0:02.809 CDs G feral_spirit Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/150: 35% maelstrom bloodlust, flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:03.660 buffs K crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/150: 54% maelstrom bloodlust, flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:04.511 CDs E berserking Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom bloodlust, flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:04.511 CDs H doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom bloodlust, berserking, flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:04.511 CDs I ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom bloodlust, berserking, flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:04.511 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:05.266 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, stormlash, lightning_crash, crashing_lightning(3), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:06.021 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, stormlash, lightning_crash, crashing_lightning(4), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:06.775 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, wind_strikes, stormlash, lightning_crash, crashing_lightning(5), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:07.531 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, stormlash, lightning_crash, crashing_lightning(6), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:08.284 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, wind_strikes, stormlash, lightning_crash, crashing_lightning(7), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:09.037 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, stormlash, lightning_crash, crashing_lightning(8), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:09.791 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, stormlash, lightning_crash, crashing_lightning(9), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:10.547 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, wind_strikes, stormlash, lightning_crash, crashing_lightning(10), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:11.301 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, stormbringer, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(11), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:12.055 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, stormbringer, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(12), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:12.809 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, stormbringer, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(13), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:13.564 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, stormbringer, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(14), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:14.320 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(15), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:15.072 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, ascendance, flametongue, frostbrand, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(15), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:15.923 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(15), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:16.836 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(15), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:17.687 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(15), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:18.538 buffs M frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, ascendance, flametongue, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(15), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:19.387 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, unleash_doom, stormlash, lightning_crash, crashing_lightning(15), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:20.238 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 132.0/150: 88% maelstrom bloodlust, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, crashing_lightning(15), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:21.088 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 136.0/150: 91% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, crashing_lightning(15), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:21.940 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, crashing_lightning(15), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:22.792 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/150: 79% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:23.643 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 148.0/150: 99% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:24.494 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/150: 82% maelstrom bloodlust, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:25.345 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/150: 75% maelstrom bloodlust, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:26.195 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/150: 65% maelstrom bloodlust, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(3), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:27.046 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/150: 55% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(4), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:27.896 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/150: 35% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(5), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:28.745 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/150: 58% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(5), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:29.595 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/150: 81% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(5), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:30.445 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 145.0/150: 97% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(5), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:31.296 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(5), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:32.147 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, stormlash, lightning_crash, crashing_lightning(5), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:32.999 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 134.0/150: 89% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, stormlash, lightning_crash, crashing_lightning(5), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:33.850 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/150: 73% maelstrom bloodlust, flametongue, frostbrand, landslide, stormlash, lightning_crash, crashing_lightning(5), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:34.701 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/150: 53% maelstrom bloodlust, flametongue, frostbrand, landslide, stormlash, lightning_crash, crashing_lightning(5), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:35.555 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/150: 72% maelstrom bloodlust, flametongue, frostbrand, landslide, stormlash, lightning_crash, crashing_lightning(5), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:36.407 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/150: 49% maelstrom bloodlust, flametongue, frostbrand, landslide, stormlash, lightning_crash, crashing_lightning(6), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:37.257 filler W crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/150: 32% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, stormlash, lightning_crash, crashing_lightning(6), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:38.107 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/150: 35% maelstrom bloodlust, ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:38.958 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/150: 35% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, crashing_lightning, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:39.810 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, crashing_lightning(2), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:40.662 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/150: 59% maelstrom bloodlust, ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, lightning_crash, crashing_lightning(2), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:41.515 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom ascendance, flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, crashing_lightning(3), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:42.620 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/150: 58% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(5), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:43.725 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/150: 62% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(6), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:44.830 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/150: 63% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(7), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:44.830 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/150: 63% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(7), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:45.936 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/150: 64% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(8), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:47.042 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(8), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:48.148 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 129.0/150: 86% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(9), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:49.253 buffs L flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/150: 66% maelstrom ascendance, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(10), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:50.358 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/150: 69% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(10), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:51.463 buffs M frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 138.0/150: 92% maelstrom ascendance, flametongue, landslide, wind_strikes, lightning_crash, crashing_lightning(10), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:52.568 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 142.0/150: 95% maelstrom ascendance, flametongue, frostbrand, landslide, wind_strikes, lightning_crash, crashing_lightning(10), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:53.672 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/150: 78% maelstrom ascendance, flametongue, frostbrand, landslide, crashing_lightning(10), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:54.778 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/150: 68% maelstrom ascendance, flametongue, frostbrand, landslide, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:55.884 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 136.0/150: 91% maelstrom ascendance, flametongue, frostbrand, landslide, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:56.988 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:58.094 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 131.0/150: 87% maelstrom ascendance, flametongue, frostbrand, landslide, wind_strikes, lightning_crash, crashing_lightning(2), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
0:59.200 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 128.0/150: 85% maelstrom flametongue, frostbrand, landslide, wind_strikes, lightning_crash, crashing_lightning(3), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:00.306 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/150: 72% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, crashing_lightning(3), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:01.413 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/150: 58% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, crashing_lightning(4), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:02.517 buffs N flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/150: 81% maelstrom flametongue, frostbrand, landslide, stormlash, lightning_crash, crashing_lightning(4), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:03.624 buffs O frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 131.0/150: 87% maelstrom flametongue, frostbrand, landslide, stormlash, lightning_crash, crashing_lightning(4), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:04.728 CDs H doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/150: 77% maelstrom flametongue, frostbrand, landslide, stormlash, lightning_crash, crashing_lightning(4), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:04.728 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/150: 77% maelstrom flametongue, frostbrand, landslide, doom_winds, stormlash, lightning_crash, crashing_lightning(4), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:05.835 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 145.0/150: 97% maelstrom flametongue, frostbrand, landslide, doom_winds, stormlash, lightning_crash, crashing_lightning(4), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:06.940 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 134.0/150: 89% maelstrom flametongue, frostbrand, landslide, doom_winds, stormlash, lightning_crash, crashing_lightning(4), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:08.045 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/150: 82% maelstrom flametongue, frostbrand, landslide, doom_winds, stormlash, lightning_crash, crashing_lightning(4), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:09.152 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/150: 75% maelstrom flametongue, frostbrand, landslide, doom_winds, stormlash, lightning_crash, crashing_lightning(4), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:10.259 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, crashing_lightning(4), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:11.363 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, crashing_lightning(5), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:12.467 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 129.0/150: 86% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, crashing_lightning(6), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:13.573 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 133.0/150: 89% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, crashing_lightning(8), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:14.677 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/150: 71% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, crashing_lightning(9), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:15.783 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/150: 71% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:16.888 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(2), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:17.994 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(3), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:19.099 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/150: 73% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, crashing_lightning(3), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:20.206 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 138.0/150: 92% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, crashing_lightning(3), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:21.311 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 138.0/150: 92% maelstrom flametongue, frostbrand, landslide, stormlash, lightning_crash, crashing_lightning(3), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:22.415 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 137.0/150: 91% maelstrom flametongue, frostbrand, landslide, stormlash, lightning_crash, crashing_lightning(3), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:23.522 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/150: 78% maelstrom flametongue, frostbrand, landslide, stormlash, lightning_crash, crashing_lightning(3), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:24.628 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, stormlash, lightning_crash, crashing_lightning(3), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:25.735 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, landslide, stormlash, lightning_crash, crashing_lightning(3), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:26.842 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, landslide, stormlash, lightning_crash, crashing_lightning(3), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:27.948 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 129.0/150: 86% maelstrom flametongue, frostbrand, landslide, lightning_crash, crashing_lightning(3), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:29.053 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/150: 72% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, lightning_crash, crashing_lightning(4), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:30.159 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/150: 62% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, crashing_lightning(5), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:30.159 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/150: 62% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, crashing_lightning(5), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:31.265 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/150: 39% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, crashing_lightning(6), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:32.369 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/150: 38% maelstrom flametongue, frostbrand, landslide, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:33.474 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/150: 61% maelstrom flametongue, frostbrand, landslide, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:34.580 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:35.688 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:36.795 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, crashing_lightning, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:37.900 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/150: 36% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, crashing_lightning(2), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:39.005 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/150: 71% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, crashing_lightning(2), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:40.111 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/150: 61% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, crashing_lightning(2), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:41.217 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/150: 81% maelstrom flametongue, frostbrand, landslide, stormlash, lightning_crash, crashing_lightning(2), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:42.321 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/150: 64% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, lightning_crash, crashing_lightning(2), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:43.427 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/150: 54% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, crashing_lightning(3), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:44.532 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/150: 27% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, crashing_lightning(4), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:45.637 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, crashing_lightning(4), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:46.742 filler W crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, crashing_lightning(4), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:47.848 filler X flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/150: 29% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:48.953 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/150: 36% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:50.061 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/150: 59% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:51.166 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/150: 51% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:52.272 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/150: 41% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:53.378 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/150: 34% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:54.483 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:55.590 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, landslide, unleash_doom, stormlash, lightning_crash, crashing_lightning, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:56.696 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:57.801 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/150: 16% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(3), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:58.907 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/150: 9% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(4), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:00.011 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/150: 41% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(4), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:01.118 filler W crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/150: 18% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, crashing_lightning(5), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:02.223 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/150: 11% maelstrom flametongue, frostbrand, landslide, wind_strikes, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:03.329 buffs N flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:04.433 buffs O frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:05.539 CDs G feral_spirit Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:06.643 buffs K crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:07.749 CDs H doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:07.749 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:08.855 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/150: 71% maelstrom flametongue, frostbrand, stormbringer, landslide, doom_winds, unleash_doom, wind_strikes, lightning_crash, crashing_lightning, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:09.960 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(2), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:11.064 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer, landslide, doom_winds, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(3), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:12.168 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer, landslide, doom_winds, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(4), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:13.273 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, doom_winds, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(5), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:14.377 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(5), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:15.482 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(7), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:15.482 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(7), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:16.588 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(8), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:17.694 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/150: 83% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(9), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:18.800 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/150: 69% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, crashing_lightning(9), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:19.907 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 148.0/150: 99% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, crashing_lightning(9), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:21.012 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, stormlash, lightning_crash, crashing_lightning(9), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:22.118 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom flametongue, frostbrand, landslide, stormlash, lightning_crash, crashing_lightning(9), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:23.225 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/150: 83% maelstrom flametongue, frostbrand, landslide, stormlash, crashing_lightning(9), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:24.329 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/150: 73% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:25.433 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 143.0/150: 95% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:26.539 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/150: 82% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:27.646 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/150: 65% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:28.752 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/150: 51% maelstrom flametongue, frostbrand, landslide, stormlash, lightning_crash, crashing_lightning, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:29.858 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/150: 71% maelstrom flametongue, frostbrand, landslide, stormlash, lightning_crash, crashing_lightning, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:30.965 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom flametongue, frostbrand, landslide, stormlash, lightning_crash, crashing_lightning, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:32.070 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, landslide, stormlash, lightning_crash, crashing_lightning, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:33.176 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, landslide, stormlash, lightning_crash, crashing_lightning, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:34.280 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 138.0/150: 92% maelstrom flametongue, frostbrand, landslide, stormlash, lightning_crash, crashing_lightning, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:35.386 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/150: 75% maelstrom flametongue, frostbrand, landslide, stormlash, lightning_crash, crashing_lightning, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:36.492 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/150: 79% maelstrom flametongue, frostbrand, landslide, stormlash, lightning_crash, crashing_lightning, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:37.597 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/150: 69% maelstrom flametongue, frostbrand, landslide, stormlash, lightning_crash, crashing_lightning, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:38.705 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 137.0/150: 91% maelstrom flametongue, frostbrand, landslide, stormlash, lightning_crash, crashing_lightning, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:39.810 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/150: 65% maelstrom flametongue, frostbrand, landslide, stormlash, crashing_lightning(2), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:40.915 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:42.018 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:43.125 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/150: 76% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:44.231 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/150: 59% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:45.337 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/150: 43% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:46.444 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/150: 35% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:47.549 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/150: 44% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:48.655 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/150: 17% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(3), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:49.761 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(3), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:50.867 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(3), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:51.972 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/150: 46% maelstrom flametongue, frostbrand, landslide, unleash_doom, stormlash, lightning_crash, crashing_lightning(3), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:53.079 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/150: 49% maelstrom flametongue, frostbrand, landslide, unleash_doom, stormlash, lightning_crash, crashing_lightning(3), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:54.185 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/150: 39% maelstrom flametongue, frostbrand, landslide, stormlash, lightning_crash, crashing_lightning(3), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:55.290 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/150: 19% maelstrom flametongue, frostbrand, landslide, stormlash, lightning_crash, crashing_lightning(3), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:56.394 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/150: 42% maelstrom flametongue, frostbrand, landslide, stormlash, crashing_lightning(3), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:57.500 Waiting     0.900 sec 220000.0/220000: 100% mana | 48.0/150: 32% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:58.400 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/150: 32% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:59.669 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/150: 9% maelstrom flametongue, frostbrand, landslide, lightning_crash, crashing_lightning, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:00.776 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/150: 31% maelstrom flametongue, frostbrand, landslide, lightning_crash, crashing_lightning, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:00.776 filler W crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/150: 31% maelstrom flametongue, frostbrand, landslide, lightning_crash, crashing_lightning, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:01.907 filler X flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/150: 31% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:03.014 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/150: 34% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:04.118 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/150: 17% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:05.224 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:06.329 buffs O frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/150: 33% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:07.436 filler W crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/150: 19% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:08.540 CDs H doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/150: 13% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:08.540 CDs I ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/150: 13% maelstrom flametongue, frostbrand, landslide, doom_winds, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:08.540 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/150: 13% maelstrom ascendance, flametongue, frostbrand, landslide, doom_winds, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:09.646 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, unleash_doom, wind_strikes, lightning_crash, crashing_lightning, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:10.751 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/150: 39% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(2), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:11.857 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/150: 62% maelstrom ascendance, flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(3), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:12.961 CDs E berserking Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/150: 69% maelstrom ascendance, flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(4), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:12.961 CDs F potion Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/150: 69% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(4), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:12.961 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/150: 69% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(4), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:13.921 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(4), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:14.882 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom berserking, ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(5), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:15.845 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom berserking, ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(7), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:16.806 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom berserking, ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(8), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:17.767 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(9), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:18.728 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 147.0/150: 98% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(10), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:19.689 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(10), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:20.652 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 147.0/150: 98% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, wind_strikes, lightning_crash, crashing_lightning(11), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:21.613 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/150: 81% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, wind_strikes, lightning_crash, crashing_lightning(11), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:22.573 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, lightning_crash, crashing_lightning(12), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:23.535 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom ascendance, flametongue, frostbrand, crashing_lightning(12), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:24.640 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, crashing_lightning(12), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:25.745 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, landslide, crashing_lightning(13), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:26.850 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/150: 73% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:27.956 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 143.0/150: 95% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:29.061 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 133.0/150: 89% maelstrom flametongue, frostbrand, landslide, wind_strikes, lightning_crash, crashing_lightning, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:30.166 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/150: 65% maelstrom flametongue, frostbrand, landslide, wind_strikes, lightning_crash, crashing_lightning(2), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:31.272 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 132.0/150: 88% maelstrom flametongue, frostbrand, landslide, wind_strikes, lightning_crash, crashing_lightning(2), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:32.378 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/150: 75% maelstrom flametongue, frostbrand, landslide, wind_strikes, lightning_crash, crashing_lightning(2), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:33.485 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 146.0/150: 97% maelstrom flametongue, frostbrand, landslide, lightning_crash, crashing_lightning(2), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:34.591 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 126.0/150: 84% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, lightning_crash, crashing_lightning(2), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:35.697 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/150: 74% maelstrom flametongue, frostbrand, landslide, wind_strikes, lightning_crash, crashing_lightning(3), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:36.801 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/150: 51% maelstrom flametongue, frostbrand, landslide, wind_strikes, lightning_crash, crashing_lightning(4), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:37.907 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom flametongue, frostbrand, landslide, wind_strikes, lightning_crash, crashing_lightning(4), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:39.013 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, lightning_crash, crashing_lightning(4), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:40.118 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, lightning_crash, crashing_lightning(5), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:41.223 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(6), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:42.329 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, crashing_lightning(7), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:43.436 buffs M frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, landslide, unleash_doom, wind_strikes, stormlash, crashing_lightning(8), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:44.541 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, crashing_lightning(8), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:45.647 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, crashing_lightning(9), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:45.647 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, crashing_lightning(9), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:46.753 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/150: 39% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, crashing_lightning(9), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:47.859 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/150: 29% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, crashing_lightning(10), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:48.964 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/150: 19% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, crashing_lightning(11), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:50.069 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/150: 12% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:51.174 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/150: 31% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:52.280 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/150: 27% maelstrom flametongue, frostbrand, landslide, wind_strikes, lightning_crash, crashing_lightning, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:53.386 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/150: 7% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(5), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:54.491 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/150: 39% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(5), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:55.595 buffs L flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/150: 59% maelstrom frostbrand, landslide, unleash_doom, lightning_crash, crashing_lightning(5), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:56.701 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/150: 62% maelstrom flametongue, frostbrand, landslide, unleash_doom, lightning_crash, crashing_lightning(5), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:57.806 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/150: 52% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(5), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:58.913 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/150: 42% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(6), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
4:00.019 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/150: 28% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(8), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
4:01.125 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/150: 54% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(8), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
4:02.230 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/150: 37% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(8), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
4:03.336 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(9), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
4:04.441 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/150: 23% maelstrom flametongue, frostbrand, landslide, wind_strikes, lightning_crash, crashing_lightning(11), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
4:05.547 CDs G feral_spirit Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/150: 42% maelstrom flametongue, frostbrand, landslide, wind_strikes, crashing_lightning(11), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
4:06.654 buffs K crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/150: 55% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, crashing_lightning(11), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
4:07.759 buffs N flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/150: 52% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
4:08.864 buffs O frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/150: 62% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
4:09.971 CDs H doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/150: 62% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
4:09.971 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/150: 62% maelstrom flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
4:11.077 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/150: 68% maelstrom flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, stormlash, lightning_crash, crashing_lightning(3), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
4:12.183 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom flametongue, frostbrand, landslide, doom_winds, wind_strikes, stormlash, lightning_crash, crashing_lightning(5), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
4:13.288 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 143.0/150: 95% maelstrom flametongue, frostbrand, landslide, doom_winds, wind_strikes, stormlash, lightning_crash, crashing_lightning(6), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:14.393 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, doom_winds, wind_strikes, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:15.499 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, doom_winds, wind_strikes, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:16.603 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, wind_strikes, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:17.707 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:18.811 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:19.917 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:21.022 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:22.127 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:23.231 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:24.337 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, lightning_crash, crashing_lightning, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:25.441 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/150: 56% maelstrom flametongue, frostbrand, landslide, wind_strikes, lightning_crash, crashing_lightning(2), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:26.546 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/150: 42% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(3), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:27.650 buffs L flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/150: 68% maelstrom frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(3), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:28.756 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/150: 71% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(3), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:29.863 buffs M frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 141.0/150: 94% maelstrom flametongue, landslide, unleash_doom, crashing_lightning(3), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:30.969 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 126.0/150: 84% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, crashing_lightning(3), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:30.969 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 126.0/150: 84% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, crashing_lightning(3), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:32.076 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/150: 74% maelstrom flametongue, frostbrand, landslide, wind_strikes, crashing_lightning(4), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:33.182 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/150: 51% maelstrom ascendance, flametongue, frostbrand, landslide, wind_strikes, stormlash, crashing_lightning(5), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:34.288 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/150: 44% maelstrom ascendance, flametongue, frostbrand, landslide, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:35.395 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom ascendance, flametongue, frostbrand, landslide, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:36.500 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 134.0/150: 89% maelstrom ascendance, flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:37.603 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/150: 73% maelstrom ascendance, flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:38.708 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/150: 59% maelstrom ascendance, flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:39.812 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/150: 52% maelstrom ascendance, flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:40.916 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/150: 75% maelstrom ascendance, flametongue, frostbrand, landslide, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:42.022 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/150: 78% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:43.128 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/150: 82% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:44.231 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/150: 68% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(2), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:45.336 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 136.0/150: 91% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(2), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:46.443 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 126.0/150: 84% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(2), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:47.548 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/150: 67% maelstrom flametongue, frostbrand, landslide, unleash_doom, stormlash, lightning_crash, crashing_lightning(2), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:48.654 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/150: 51% maelstrom flametongue, frostbrand, landslide, stormlash, lightning_crash, crashing_lightning(2), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:49.760 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, landslide, stormlash, crashing_lightning(2), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:50.866 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/150: 73% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:51.972 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/150: 59% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4728 4403 0
Agility 44332 38901 28018 (24626)
Stamina 81377 81377 45295
Intellect 7649 7324 0
Spirit 1 1 0
Health 4882620 4882620 0
Mana 220000 220000 0
Maelstrom 150 150 0
Spell Power 53198 46681 0
Crit 18.60% 18.60% 3439
Haste 36.17% 36.17% 13565
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 44332 38901 0
Mastery 60.58% 60.58% 8916
Armor 3282 3282 3282
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 939.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of the Skybreaker
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +871 Crit, +515 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Flesh-Raking Leggings
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Mastery }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }, gems: { +150 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Eye of the Twisting Nether
ilevel: 970, stats: { +3515 Sta, +2884 Haste, +1602 Mastery }, gems: { +200 Agi }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Specter of Betrayal
ilevel: 940, stats: { +2994 StrAgi }
Local Trinket2 Cradle of Anguish
ilevel: 930, stats: { +1320 Haste }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Agi }
Local Main Hand Doomhammer
ilevel: 951, weapon: { 8445 - 15685, 2.6 }, stats: { +1496 Agi, +2244 Sta, +435 Crit, +418 Mastery }, relics: { +67 ilevels, +67 ilevels, +67 ilevels }
Local Off Hand Fury of the Stonemother
ilevel: 951, weapon: { 8445 - 15685, 2.6 }, stats: { +1496 Agi, +2244 Sta, +435 Crit, +418 Mastery }

Talents

Level
15 Windsong (Enhancement Shaman) Hot Hand (Enhancement Shaman) Landslide (Enhancement Shaman)
30 Rainfall (Enhancement Shaman) Feral Lunge (Enhancement Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Lightning Shield (Enhancement Shaman) Ancestral Swiftness Hailstorm (Enhancement Shaman)
75 Tempest (Enhancement Shaman) Overcharge (Enhancement Shaman) Empowered Stormlash (Enhancement Shaman)
90 Crashing Storm (Enhancement Shaman) Fury of Air (Enhancement Shaman) Sundering (Enhancement Shaman)
100 Ascendance (Enhancement Shaman) Boulderfist (Enhancement Shaman) Earthen Spike (Enhancement Shaman)

Profile

shaman="T19 2pc - T20 4pc"
spec=enhancement
level=110
race=troll
role=attack
position=back
talents=3133111
artifact=41:0:0:0:0:899:1:900:1:901:1:902:1:903:1:904:1:905:4:906:4:907:4:908:4:909:4:910:4:911:4:912:4:913:4:930:1:1351:1:1388:1:1593:4:1594:1:1595:1:1596:1:1687:1

# Default consumables
potion=prolonged_power
flask=seventh_demon
food=lavish_suramar_feast
augmentation=defiled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/lightning_shield

# Executed every time the actor is available.
actions=wind_shear
actions+=/variable,name=hailstormCheck,value=((talent.hailstorm.enabled&!buff.frostbrand.up)|!talent.hailstorm.enabled)
actions+=/variable,name=furyCheck80,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>80))
actions+=/variable,name=furyCheck70,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>70))
actions+=/variable,name=furyCheck45,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>45))
actions+=/variable,name=furyCheck25,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>25))
actions+=/variable,name=OCPool70,value=(!talent.overcharge.enabled|(talent.overcharge.enabled&maelstrom>70))
actions+=/variable,name=OCPool60,value=(!talent.overcharge.enabled|(talent.overcharge.enabled&maelstrom>60))
actions+=/variable,name=heartEquipped,value=(equipped.151819)
actions+=/variable,name=akainuEquipped,value=(equipped.137084)
actions+=/variable,name=akainuAS,value=(variable.akainuEquipped&buff.hot_hand.react&!buff.frostbrand.up)
actions+=/variable,name=LightningCrashNotUp,value=(!buff.lightning_crash.up&set_bonus.tier20_2pc)
actions+=/variable,name=alphaWolfCheck,value=((pet.frost_wolf.buff.alpha_wolf.remains<2&pet.fiery_wolf.buff.alpha_wolf.remains<2&pet.lightning_wolf.buff.alpha_wolf.remains<2)&feral_spirit.remains>4)
actions+=/auto_attack
actions+=/use_items
actions+=/call_action_list,name=opener
actions+=/windstrike,if=(variable.heartEquipped|set_bonus.tier19_2pc)&(!talent.earthen_spike.enabled|(cooldown.earthen_spike.remains>1&cooldown.doom_winds.remains>1)|debuff.earthen_spike.up)
actions+=/call_action_list,name=buffs
actions+=/call_action_list,name=CDs
actions+=/call_action_list,name=core
actions+=/call_action_list,name=filler

actions.CDs=bloodlust,if=target.health.pct<25|time>0.500
actions.CDs+=/berserking,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
actions.CDs+=/blood_fury,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
actions.CDs+=/potion,if=buff.ascendance.up|!talent.ascendance.enabled&feral_spirit.remains>5|target.time_to_die<=60
actions.CDs+=/feral_spirit
actions.CDs+=/doom_winds,if=debuff.earthen_spike.up&talent.earthen_spike.enabled|!talent.earthen_spike.enabled
actions.CDs+=/ascendance,if=buff.doom_winds.up

actions.buffs=rockbiter,if=talent.landslide.enabled&!buff.landslide.up
actions.buffs+=/fury_of_air,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
actions.buffs+=/crash_lightning,if=artifact.alpha_wolf.rank&prev_gcd.1.feral_spirit
actions.buffs+=/flametongue,if=!buff.flametongue.up
actions.buffs+=/frostbrand,if=talent.hailstorm.enabled&!buff.frostbrand.up&variable.furyCheck45
actions.buffs+=/flametongue,if=buff.flametongue.remains<6+gcd&cooldown.doom_winds.remains<gcd*2
actions.buffs+=/frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<6+gcd&cooldown.doom_winds.remains<gcd*2

actions.core=earthen_spike,if=variable.furyCheck25
actions.core+=/crash_lightning,if=!buff.crash_lightning.up&active_enemies>=2
actions.core+=/windsong
actions.core+=/crash_lightning,if=active_enemies>=8|(active_enemies>=6&talent.crashing_storm.enabled)
actions.core+=/windstrike
actions.core+=/stormstrike,if=buff.stormbringer.up&variable.furyCheck25
actions.core+=/crash_lightning,if=active_enemies>=4|(active_enemies>=2&talent.crashing_storm.enabled)
actions.core+=/lightning_bolt,if=talent.overcharge.enabled&variable.furyCheck45&maelstrom>=40
actions.core+=/stormstrike,if=(!talent.overcharge.enabled&variable.furyCheck45)|(talent.overcharge.enabled&variable.furyCheck80)
actions.core+=/frostbrand,if=variable.akainuAS
actions.core+=/lava_lash,if=buff.hot_hand.react&((variable.akainuEquipped&buff.frostbrand.up)|!variable.akainuEquipped)
actions.core+=/sundering,if=active_enemies>=3
actions.core+=/crash_lightning,if=active_enemies>=3|variable.LightningCrashNotUp|variable.alphaWolfCheck

actions.filler=rockbiter,if=maelstrom<120
actions.filler+=/flametongue,if=buff.flametongue.remains<4.8
actions.filler+=/rockbiter,if=maelstrom<=40
actions.filler+=/crash_lightning,if=(talent.crashing_storm.enabled|active_enemies>=2)&debuff.earthen_spike.up&maelstrom>=40&variable.OCPool60
actions.filler+=/frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<4.8&maelstrom>40
actions.filler+=/frostbrand,if=variable.akainuEquipped&!buff.frostbrand.up&maelstrom>=75
actions.filler+=/sundering
actions.filler+=/lava_lash,if=maelstrom>=50&variable.OCPool70&variable.furyCheck80
actions.filler+=/rockbiter
actions.filler+=/crash_lightning,if=(maelstrom>=65|talent.crashing_storm.enabled|active_enemies>=2)&variable.OCPool60&variable.furyCheck45
actions.filler+=/flametongue

actions.opener=rockbiter,if=maelstrom<15&time<2

head=helmet_of_the_skybreaker,id=147178,bonus_id=1512/3563
neck=string_of_extracted_incisors,id=147013,bonus_id=1512/3563,enchant_id=5439
shoulders=pauldrons_of_the_skybreaker,id=147180,bonus_id=1512/3563
back=drape_of_the_skybreaker,id=147176,bonus_id=1512/3563,enchant_id=5435
chest=harness_of_the_skybreaker,id=147175,bonus_id=1512/3563
wrists=painsinged_armguards,id=147057,bonus_id=1512/3563
hands=smoldering_heart,id=151819,bonus_id=3570
waist=waistguard_of_interminable_unity,id=147056,bonus_id=1512/3563
legs=fleshraking_leggings,id=147051,bonus_id=1512/3563
feet=starstalker_treads,id=147046,bonus_id=1522/3563,gem_id=130222
finger1=eye_of_the_twisting_nether,id=137050,bonus_id=3570,gem_id=130247,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,bonus_id=1512/3563,enchant=200haste
trinket1=specter_of_betrayal,id=151190,bonus_id=1522/3563
trinket2=cradle_of_anguish,id=147010,bonus_id=1512/3563
main_hand=doomhammer,id=128819,bonus_id=745,gem_id=147088/147100/147115,relic_id=1512:3563/1512:3563/1512:3563
off_hand=fury_of_the_stonemother,id=128873,gem_id=0/0/0/0,relic_id=0/0

# Gear Summary
# gear_ilvl=938.88
# gear_agility=28018
# gear_stamina=45295
# gear_crit_rating=3439
# gear_haste_rating=13565
# gear_mastery_rating=8916
# gear_versatility_rating=2624
# gear_armor=3282
# set_bonus=tier19_2pc=1
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

T19 4pc : 1334269 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1334268.5 1334268.5 2926.4 / 0.219% 297902.4 / 22.3% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.43% 60.6 99.8% 100%
Talents
  • 15: Landslide (Enhancement Shaman)
  • 30: Rainfall (Enhancement Shaman)
  • 45: Voodoo Totem
  • 60: Hailstorm (Enhancement Shaman)
  • 75: Tempest (Enhancement Shaman)
  • 90: Crashing Storm (Enhancement Shaman)
  • 100: Ascendance (Enhancement Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
T19 4pc 1334269
Crash Lightning 7802 (12518) 0.6% (1.0%) 10.5 27.20sec 359741 343071 Direct 10.5 189268 378609 224223 18.5% 0.0%  

Stats details: crash_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.53 10.53 0.00 0.00 1.0487 0.0000 2361625.51 2361625.51 0.00 343071.09 343071.09
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.59 81.54% 189267.95 179239 202409 189414.59 0 202409 1625329 1625329 0.00
crit 1.94 18.46% 378609.19 358479 404819 318039.88 0 404819 736297 736297 0.00
 
 

Action details: crash_lightning

Static Values
  • id:187874
  • school:nature
  • resource:maelstrom
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:artifact.alpha_wolf.rank&prev_gcd.1.feral_spirit
Spelldata
  • id:187874
  • name:Crash Lightning
  • school:nature
  • tooltip:Stormstrike and Lava Lash deal an additional $195592sw1 damage to all targets in front of you.
  • description:Electrocutes all enemies in front of you, dealing $sw1 Nature damage. Hitting 2 or more targets enhances your weapons for {$187878d=10 seconds}, causing Stormstrike and Lava Lash to also deal $195592sw1 Nature damage to all targets in front of you.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.50
 
    Crashing Storm 4716 0.4% 73.0 3.67sec 19558 0 Direct 73.0 16502 33022 19558 18.5% 0.0%  

Stats details: crashing_storm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.97 72.97 0.00 0.00 0.0000 0.0000 1427251.62 1427251.62 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.47 81.50% 16501.74 14519 18094 16533.84 15774 17959 981361 981361 0.00
crit 13.50 18.50% 33022.08 29037 36187 33074.02 29037 36187 445891 445891 0.00
 
 

Action details: crashing_storm

Static Values
  • id:210801
  • school:nature
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210801
  • name:Crashing Storm
  • school:nature
  • tooltip:
  • description:{$@spelldesc192246=Crash Lightning also electrifies the ground, leaving an electrical field behind which damages enemies within it for ${7*{$210801s1=1}} Nature damage over {$210797d=6 seconds}. }
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.160000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Dread Torrent 39330 3.0% 52.9 10.60sec 222920 0 Direct 52.9 187692 375374 222909 18.8% 0.0%  

Stats details: dread_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.90 52.90 0.00 0.00 0.0000 0.0000 11791433.22 11791433.22 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.97 81.23% 187692.34 182405 187918 187687.68 186686 187918 8064606 8064606 0.00
crit 9.93 18.77% 375373.61 364809 375836 375370.80 372151 375836 3726827 3726827 0.00
 
 

Action details: dread_torrent

Static Values
  • id:246464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246464
  • name:Dread Torrent
  • school:shadow
  • tooltip:
  • description:{$@spelldesc246461=Create a Dread Reflection at your location for {$d=60 seconds} and cause each of your Dread Reflections to unleash a torrent of magic that deals ${{$246464s1=39731 to 43913}*4} Shadow damage over {$246463d=3 seconds}, split evenly among nearby enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:140074.50
  • base_dd_max:154819.18
 
Flametongue 14979 (66642) 1.1% (5.0%) 19.7 15.52sec 1010357 952839 Direct 19.7 192340 384288 227874 18.5% 0.0%  

Stats details: flametongue

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.71 19.71 0.00 0.00 1.0604 0.0000 4491238.89 4491238.89 0.00 952838.58 952838.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.06 81.49% 192339.64 179999 210826 192434.42 185547 201484 3089088 3089088 0.00
crit 3.65 18.51% 384288.49 359999 421651 376598.96 0 421651 1402151 1402151 0.00
 
 

Action details: flametongue

Static Values
  • id:193796
  • school:fire
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!buff.flametongue.up
Spelldata
  • id:193796
  • name:Flametongue
  • school:fire
  • tooltip:
  • description:Scorches your target, dealing {$s2=1} Fire damage, and enhances your weapons with fire for {$194084d=16 seconds}, causing each weapon attack to deal up to ${$<coeff>*$AP} Fire damage, based on weapon speed.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Flametongue Attack 51663 3.9% 916.1 0.59sec 16834 0 Direct 916.1 14189 28382 16834 18.6% 0.0%  

Stats details: flametongue_attack

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 916.13 916.13 0.00 0.00 0.0000 0.0000 15422134.60 15422134.60 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 745.38 81.36% 14188.84 12111 15550 14193.45 13885 14614 10576109 10576109 0.00
crit 170.75 18.64% 28381.86 24586 31099 28391.62 27683 29526 4846025 4846025 0.00
 
 

Action details: flametongue_attack

Static Values
  • id:10444
  • school:fire
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:{$@spelldesc193796=Scorches your target, dealing {$s2=1} Fire damage, and enhances your weapons with fire for {$194084d=16 seconds}, causing each weapon attack to deal up to ${$<coeff>*$AP} Fire damage, based on weapon speed.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Frostbrand 8858 (122126) 0.7% (9.2%) 18.9 16.22sec 1935027 1824055 Direct 18.9 118672 237462 140838 18.7% 0.0%  

Stats details: frostbrand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.85 18.85 86.98 0.00 1.0609 3.3143 2655336.80 2655336.80 0.00 118334.50 1824055.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.33 81.34% 118672.27 109360 130010 118718.02 114858 124069 1819766 1819766 0.00
crit 3.52 18.66% 237461.51 222001 260020 230287.23 0 260020 835570 835570 0.00
 
 

Action details: frostbrand

Static Values
  • id:196834
  • school:frost
  • resource:maelstrom
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.hailstorm.enabled&!buff.frostbrand.up&variable.furyCheck45
Spelldata
  • id:196834
  • name:Frostbrand
  • school:frost
  • tooltip:Melee attacks reduce target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
  • description:Chills your target, dealing {$s1=1} Frost damage and reducing the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}, and enhances your weapons with frost for {$d=16 seconds}, causing each weapon attack to reduce the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.925000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.00
  • base_tick_time:5.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Hailstorm 113268 8.5% 905.1 0.60sec 37372 0 Direct 905.1 31503 63011 37372 18.6% 0.0%  

Stats details: hailstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 905.10 905.10 0.00 0.00 0.0000 0.0000 33825769.23 33825769.23 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 736.50 81.37% 31502.89 28255 33735 31510.59 30996 32252 23201646 23201646 0.00
crit 168.61 18.63% 63011.26 56510 67470 63025.90 61779 64593 10624124 10624124 0.00
 
 

Action details: hailstorm

Static Values
  • id:210854
  • school:frost
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210854
  • name:Hailstorm
  • school:frost
  • tooltip:
  • description:{$@spelldesc210853=Frostbrand now also enhances your weapon's damage, causing each of your weapon attacks to also deal $210854sw1 Frost damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.30
 
Lava Lash 108776 (120982) 8.2% (9.1%) 42.2 6.74sec 860916 811018 Direct 42.2 652797 1300516 773899 18.7% 0.0%  

Stats details: lava_lash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.19 42.19 0.00 0.00 1.0615 0.0000 32649162.83 32649162.83 0.00 811017.79 811017.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.30 81.30% 652797.23 454911 1478679 659039.11 561656 928664 22388592 22388592 0.00
crit 7.89 18.70% 1300516.26 909823 2957357 1311739.98 0 2800258 10260571 10260571 0.00
 
 

Action details: lava_lash

Static Values
  • id:60103
  • school:fire
  • resource:maelstrom
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.hot_hand.react&((variable.akainuEquipped&buff.frostbrand.up)|!variable.akainuEquipped)
Spelldata
  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing $sw1 Fire damage.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:7.81
 
    Doom Vortex (_ll) 12206 0.9% 50.1 5.24sec 73319 0 Direct 50.1 61815 123588 73317 18.6% 0.0%  

Stats details: doom_vortex_ll

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.06 50.06 0.00 0.00 0.0000 0.0000 3670646.84 3670646.84 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.74 81.38% 61815.21 53634 67845 61844.73 58700 65924 2518413 2518413 0.00
crit 9.32 18.62% 123588.47 107269 135691 123490.97 0 135691 1152233 1152233 0.00
 
 

Action details: doom_vortex_ll

Static Values
  • id:199116
  • school:fire
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:199116
  • name:Doom Vortex
  • school:fire
  • tooltip:
  • description:{$@spelldesc199107=Lava Lash{$?s210727=false}[ and Lightning Bolt have][ has] a chance to cause |cFFFFCC99Doomhammer|r to release a fiery tornado at your target's location, dealing ${3*{$199116s1=1}} Fire damage over {$199121d=3 seconds} to enemies within $199116A1 yards.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.600000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
main_hand 18824 1.4% 133.1 2.26sec 42602 27227 Direct 133.1 42797 85567 42600 18.5% 19.0%  

Stats details: main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 133.07 133.07 0.00 0.00 1.5647 0.0000 5669017.99 8333993.42 31.98 27227.14 27227.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 83.13 62.47% 42797.16 37865 46041 42811.44 41802 44086 3557700 5230155 31.98
crit 24.67 18.54% 85566.98 75731 92082 85601.59 82821 89057 2111318 3103838 31.98
miss 25.27 18.99% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Mark of the Hidden Satyr 20967 1.6% 20.5 14.54sec 306054 0 Direct 20.5 257265 514287 306050 19.0% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.49 20.49 0.00 0.00 0.0000 0.0000 6271961.85 6271961.85 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.60 81.02% 257264.57 223468 282681 257343.40 246855 270110 4271284 4271284 0.00
crit 3.89 18.98% 514286.99 446936 565361 504707.13 0 565361 2000678 2000678 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
offhand 9392 0.7% 132.5 2.25sec 21342 13589 Direct 132.5 21412 42819 21341 18.7% 19.0%  

Stats details: offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 132.53 132.53 0.00 0.00 1.5705 0.0000 2828408.85 4158028.92 31.98 13589.43 13589.43
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 82.62 62.34% 21412.08 18933 23021 21419.94 21017 22080 1769016 2600621 31.98
crit 24.74 18.67% 42818.78 38433 46041 42833.14 41437 44665 1059393 1557408 31.98
miss 25.17 18.99% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: offhand

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Rockbiter 98970 7.5% 56.9 5.21sec 523169 488831 Direct 56.9 440359 880775 523182 18.8% 0.0%  

Stats details: rockbiter

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.88 56.88 0.00 0.00 1.0703 0.0000 29759048.39 29759048.39 0.00 488830.91 488830.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 46.19 81.20% 440359.40 406397 483136 440571.92 427771 454557 20338707 20338707 0.00
crit 10.70 18.80% 880775.02 824986 966273 881352.46 837361 940931 9420342 9420342 0.00
 
 

Action details: rockbiter

Static Values
  • id:193786
  • school:nature
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.landslide.enabled&!buff.landslide.up
Spelldata
  • id:193786
  • name:Rockbiter
  • school:nature
  • tooltip:
  • description:Assaults your target with earthen power, dealing {$s1=0} Nature damage. |cFFFFFFFFGenerates {$s2=25} Maelstrom.|r
 
Stormlash 38082 2.9% 699.5 1.08sec 16287 0 Direct 699.5 16289 0 16289 0.0% 0.0%  

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 699.54 699.54 0.00 0.00 0.0000 0.0000 11393647.47 11393647.47 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 699.54 100.00% 16288.59 2677 102539 16284.13 14164 18131 11393647 11393647 0.00
 
 

Action details: stormlash

Static Values
  • id:213307
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:213307
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:{$@spelldesc195255=While your weapons are enhanced, your attacks have a chance to grant Stormlash to up to {$?s210731=false}[${$m1+$210731m1}][{$s1=2}] party or raid members for {$195222d=8 seconds}, causing attacks and spellcasts to deal additional Nature damage.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:2.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:28355.29
  • base_dd_max:28355.29
 
Stormstrike 0 (270682) 0.0% (20.4%) 77.7 3.56sec 1046422 970122

Stats details: stormstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.71 0.00 0.00 0.00 1.0787 0.0000 0.00 0.00 0.00 970122.02 970122.02
 
 

Action details: stormstrike

Static Values
  • id:17364
  • school:physical
  • resource:maelstrom
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.stormbringer.up&variable.furyCheck25
Spelldata
  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of ${$32175sw1+$32176sw1} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
    Stormstrike (_mh) 180493 13.6% 97.1 3.56sec 558211 0 Direct 97.1 365767 892483 558219 36.5% 0.0%  

Stats details: stormstrike_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.14 97.14 0.00 0.00 0.0000 0.0000 54224222.74 79714743.69 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.65 63.46% 365766.97 150336 572971 366517.94 309265 457675 22546940 33146137 31.98
crit 35.49 36.54% 892482.63 300671 1145942 893740.67 719124 995381 31677283 46568607 31.98
 
 

Action details: stormstrike_mh

Static Values
  • id:32175
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of ${$32175sw1+$32176sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:7.50
 
    Stormstrike Off-Hand 90188 6.8% 97.1 3.56sec 278942 0 Direct 97.1 182988 445997 278943 36.5% 0.0%  

Stats details: stormstrike_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.14 97.14 0.00 0.00 0.0000 0.0000 27096255.54 39834062.27 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.70 63.52% 182988.32 75168 286486 183352.45 152519 219516 11289326 16596378 31.98
crit 35.44 36.48% 445997.07 150336 572971 446650.71 378292 500945 15806930 23237684 31.98
 
 

Action details: stormstrike_offhand

Static Values
  • id:32176
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of ${$32175sw1+$32176sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:7.50
 
Unleash Lava 47840 3.6% 133.4 3.05sec 106569 0 Direct 131.9 90920 181788 107837 18.6% 0.0%  

Stats details: unleash_lava

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 133.43 131.86 0.00 0.00 0.0000 0.0000 14219632.14 14219632.14 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 107.31 81.38% 90919.53 78663 99506 90947.65 87512 94917 9756765 9756765 0.00
crit 24.55 18.62% 181788.07 157326 199012 181838.81 172996 192346 4462867 4462867 0.00
 
 

Action details: unleash_lava

Static Values
  • id:199053
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:1.2000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:199053
  • name:Unleash Lava
  • school:fire
  • tooltip:
  • description:{$@spelldesc198736=Stormstrike has a chance to unleash the power of |cFFFFCC99Doomhammer|r, causing your special attacks to heave molten lava or lightning spikes at your target for {$199053s1=1} Fire or Nature damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.800000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Unleash Lightning 47624 3.6% 132.9 3.06sec 106554 0 Direct 131.3 90889 181827 107850 18.7% 0.0%  

Stats details: unleash_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 132.89 131.29 0.00 0.00 0.0000 0.0000 14159704.50 14159704.50 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 106.80 81.35% 90889.46 78663 99506 90916.20 88237 94996 9706997 9706997 0.00
crit 24.49 18.65% 181827.19 157326 199012 181870.74 170516 194781 4452708 4452708 0.00
 
 

Action details: unleash_lightning

Static Values
  • id:199054
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:1.2000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:199054
  • name:Unleash Lightning
  • school:nature
  • tooltip:
  • description:{$@spelldesc198736=Stormstrike has a chance to unleash the power of |cFFFFCC99Doomhammer|r, causing your special attacks to heave molten lava or lightning spikes at your target for {$199053s1=1} Fire or Nature damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.800000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Windlash (wind_lash) 13991 1.0% 55.0 4.90sec 74973 57642 Direct 55.0 63214 126405 74972 18.6% 0.0%  

Stats details: wind_lash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.02 55.02 0.00 0.00 1.3007 0.0000 4125403.83 4125403.83 0.00 57641.52 57641.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.78 81.39% 63214.03 55666 67685 63250.47 61274 66789 2830947 2830947 0.00
crit 10.24 18.61% 126405.17 113001 135370 126463.47 119174 135370 1294457 1294457 0.00
 
 

Action details: wind_lash

Static Values
  • id:114089
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114089
  • name:Windlash
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals $sw1 Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Windlash Off-Hand (wind_lash_offhand) 7001 0.5% 55.0 4.90sec 37504 28879 Direct 55.0 31606 63205 37505 18.7% 0.0%  

Stats details: wind_lash_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.04 55.04 0.00 0.00 1.2986 0.0000 2064361.82 2064361.82 0.00 28879.46 28879.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.77 81.33% 31605.79 27833 33842 31623.48 30591 33290 1414961 1414961 0.00
crit 10.27 18.67% 63204.63 56501 67685 63241.88 59027 67685 649400 649400 0.00
 
 

Action details: wind_lash_offhand

Static Values
  • id:114093
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114093
  • name:Windlash Off-Hand
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals $sw1 Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Windfury Attack 70608 5.3% 181.8 3.33sec 115716 0 Direct 181.8 97582 195232 115709 18.6% 0.0%  

Stats details: windfury_attack

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 181.84 181.84 0.00 0.00 0.0000 0.0000 21041852.81 30933516.78 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 148.08 81.44% 97582.41 55030 200065 97804.62 83440 116456 14451440 21244986 31.98
crit 33.76 18.56% 195232.35 111710 400130 195642.84 132075 269108 6590412 9688530 31.98
 
 

Action details: windfury_attack

Static Values
  • id:25504
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Each of your main hand attacks has a {$33757h=20}% chance to trigger two extra attacks, dealing $25504sw2 Physical damage each.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Windfury Attack (_oh) 14232 1.1% 38.3 14.79sec 110730 0 Direct 38.3 93598 187192 110732 18.3% 0.0%  

Stats details: windfury_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.30 38.30 0.00 0.00 0.0000 0.0000 4240817.31 6234403.15 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.29 81.69% 93597.52 83783 100032 93628.65 89739 97883 2928453 4305104 31.98
crit 7.01 18.31% 187192.10 167566 200065 187263.82 171651 200065 1312364 1929299 31.98
 
 

Action details: windfury_attack_oh

Static Values
  • id:33750
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:33750
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:$@spelldesc8232
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Windstrike 0 (274284) 0.0% (20.3%) 55.5 4.86sec 1454154 1482915

Stats details: windstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.49 0.00 0.00 0.00 0.9806 0.0000 0.00 0.00 0.00 1482915.09 1482915.09
 
 

Action details: windstrike

Static Values
  • id:115356
  • school:physical
  • resource:maelstrom
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(variable.heartEquipped|set_bonus.tier19_2pc)&(!talent.earthen_spike.enabled|(cooldown.earthen_spike.remains>1&cooldown.doom_winds.remains>1)|debuff.earthen_spike.up)
Spelldata
  • id:115356
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:Hurl a staggering blast of wind at an enemy, dealing a total of ${$115357sw1+$115360sw1} Physical damage, bypassing armor.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
    Windstrike (_mh) 182903 13.5% 69.4 4.86sec 775500 0 Direct 69.4 532701 1276590 775614 32.7% 0.0%  

Stats details: windstrike_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.38 69.37 0.00 0.00 0.0000 0.0000 53802338.28 53802338.28 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 46.72 67.35% 532701.32 209035 842322 534365.37 438685 643298 24886102 24886102 0.00
crit 22.65 32.65% 1276589.98 418069 1684644 1279819.45 993711 1477888 28916236 28916236 0.00
 
 

Action details: windstrike_mh

Static Values
  • id:115357
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115357
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of ${$115357sw1+$115360sw1} Physical damage, bypassing armor.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:7.50
 
    Windstrike Off-Hand 91382 6.8% 69.4 4.86sec 387532 0 Direct 69.4 266449 638065 387596 32.6% 0.0%  

Stats details: windstrike_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.38 69.37 0.00 0.00 0.0000 0.0000 26886037.47 26886037.47 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 46.76 67.40% 266448.73 104517 421161 267374.90 225368 315319 12458183 12458183 0.00
crit 22.61 32.60% 638065.07 209035 842322 639400.99 479071 746228 14427855 14427855 0.00
 
 

Action details: windstrike_offhand

Static Values
  • id:115360
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115360
  • name:Windstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of ${$115357sw1+$115360sw1} Physical damage, bypassing armor.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:7.50
 
pet - frost_wolf 316224 / 19661
Frozen Bite 144763 0.7% 8.5 29.47sec 318851 0 Direct 8.5 269022 536889 318870 18.6% 0.0%  

Stats details: frozen_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.45 8.45 0.00 0.00 0.0000 0.0000 2694466.42 2694466.42 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.88 81.40% 269022.09 236633 294910 268432.02 0 294910 1850658 1850658 0.00
crit 1.57 18.60% 536888.92 473265 589819 416243.44 0 589819 843808 843808 0.00
 
 

Action details: frozen_bite

Static Values
  • id:224126
  • school:frost
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224126
  • name:Frozen Bite
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Bite the target, causing {$s1=1} Frost damage and slowing the target's movement speed by {$s2=50}% for {$d=4 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
melee 102625 0.5% 49.1 4.49sec 38873 46376 Direct 49.1 32772 65523 38873 18.6% 0.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.07 49.07 0.00 0.00 0.8382 0.0000 1907544.57 2804271.21 31.98 46376.17 46376.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.93 81.38% 32771.80 28640 35693 32734.60 29327 35693 1308687 1923893 31.98
crit 9.14 18.62% 65523.31 57279 71386 65026.82 0 71386 598858 880378 31.77
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Snowstorm 68835 0.3% 14.8 14.80sec 85597 0 Direct 14.8 72159 144177 85589 18.7% 0.0%  

Stats details: snowstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.84 14.84 0.00 0.00 0.0000 0.0000 1270231.86 1270231.86 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.07 81.35% 72159.22 63102 78642 71843.06 0 78642 871084 871084 0.00
crit 2.77 18.65% 144177.44 126203 157284 130094.19 0 157284 399148 399148 0.00
 
 

Action details: snowstorm

Static Values
  • id:198483
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198483
  • name:Snowstorm
  • school:frost
  • tooltip:
  • description:Deals {$s1=0} Frost damage to all targets within $A1 yards.
 
pet - fiery_wolf 395024 / 23729
Fiery Jaws 223877 1.0% 8.1 29.47sec 496739 0 Direct 8.1 179400 358755 212871 18.7% 0.0%  
Periodic 32.1 71855 0 71855 0.0% 0.0% 10.7%

Stats details: fiery_jaws

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.12 8.12 32.08 32.08 0.0000 1.0000 4033462.20 4033462.20 0.00 125727.45 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.61 81.35% 179399.78 157756 196607 178651.87 0 196607 1184933 1184933 0.00
crit 1.51 18.65% 358754.90 315511 393214 273051.85 0 393214 543389 543389 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.1 100.00% 71855.12 63103 78644 71720.64 0 78158 2305140 2305140 0.00
 
 

Action details: fiery_jaws

Static Values
  • id:224125
  • school:fire
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224125
  • name:Fiery Jaws
  • school:fire
  • tooltip:Suffering {$s2=1} Fire damage every $t sec.
  • description:Bite the target for {$s1=1} Fire damage, causing an additional $o2 Fire damage over {$d=4 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.400000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Fire Nova 68125 0.3% 14.3 14.82sec 85620 0 Direct 14.3 72164 144203 85621 18.7% 0.0%  

Stats details: fire_nova

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.26 14.26 0.00 0.00 0.0000 0.0000 1221084.44 1221084.44 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.60 81.32% 72164.07 63102 78642 71783.00 0 78642 836850 836850 0.00
crit 2.66 18.68% 144202.83 126203 157284 128218.04 0 157284 384235 384235 0.00
 
 

Action details: fire_nova

Static Values
  • id:198480
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198480
  • name:Fire Nova
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to all targets within $A1 yards.
 
melee 103022 0.5% 47.2 4.50sec 38966 46547 Direct 47.2 32789 65526 38969 18.9% 0.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.22 47.22 0.00 0.00 0.8371 0.0000 1839897.51 2704823.62 31.98 46546.69 46546.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.31 81.13% 32789.21 28640 35693 32736.37 0 35693 1256010 1846453 31.96
crit 8.91 18.87% 65526.42 57279 71386 64994.39 0 71386 583888 858371 31.74
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lightning_wolf 239436 / 14602
melee 142256 0.7% 47.9 4.55sec 54119 64734 Direct 47.9 45623 91198 54120 18.6% 0.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.92 47.92 0.00 0.00 0.8360 0.0000 2593306.66 3812406.44 31.98 64733.95 64733.95
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.98 81.35% 45622.96 28640 53539 45575.48 39849 53100 1778469 2614518 31.98
crit 8.94 18.65% 91197.63 57279 107079 90430.40 0 107079 814838 1197889 31.74
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Thunder Bite 97181 0.4% 14.4 14.95sec 123419 0 Direct 14.4 104562 208585 123425 18.1% 0.0%  

Stats details: thunder_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.35 14.35 0.00 0.00 0.0000 0.0000 1771398.23 1771398.23 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.75 81.87% 104562.21 63102 117963 103988.52 0 117963 1228568 1228568 0.00
crit 2.60 18.13% 208585.12 126203 235926 183446.72 0 235926 542830 542830 0.00
 
 

Action details: thunder_bite

Static Values
  • id:198485
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198485
  • name:Thunder Bite
  • school:nature
  • tooltip:
  • description:Deals {$s1=0} Nature damage, jumping to up to $x targets.
 
Simple Action Stats Execute Interval
T19 4pc
Ascendance 2.0 185.45sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.04 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114051
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.doom_winds.up
Spelldata
  • id:114051
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a $114089r yard range. Stormstrike is empowered and has a $114089r yard range.
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, reducing the cooldown and cost of Stormstrike by {$s4=80}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$s1=30} yd range.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T19 4pc
  • harmful:false
  • if_expr:
 
Berserking 2.0 189.75sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.03 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ascendance.up|(feral_spirit.remains>5)|level<100
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Doom Winds 5.3 61.72sec

Stats details: doom_winds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.33 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: doom_winds

Static Values
  • id:204945
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:debuff.earthen_spike.up&talent.earthen_spike.enabled|!talent.earthen_spike.enabled
Spelldata
  • id:204945
  • name:Doom Winds
  • school:physical
  • tooltip:Chance to proc Windfury weapon on auto attacks increased by 100%. Windfury damage increased by {$s2=200}%.
  • description:Unleashes the inner power of the |cFFFFCC99Doomhammer|r, causing all auto attacks to trigger Windfury, and increasing damage dealt by Windfury by {$s2=200}% for {$d=6 seconds}.
 
Feral Spirit 3.0 121.13sec

Stats details: feral_spirit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.97 0.00 0.00 0.00 1.0189 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: feral_spirit

Static Values
  • id:51533
  • school:nature
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects$?a231723[ and grant you {$190185s1=5} Maelstrom each time they attack][].
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T19 4pc
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T19 4pc
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
pet - lightning_wolf
Crackling Surge 8.3 30.19sec

Stats details: crackling_surge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.26 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: crackling_surge

Static Values
  • id:224127
  • school:nature
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224127
  • name:Crackling Surge
  • school:nature
  • tooltip:Damage dealt increased by {$s1=50}%.
  • description:The Doom Wolf surges with electric energy, increasing all damage dealt by {$s1=50}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 6.4 0.1 47.5sec 46.5sec 27.63% 87.87% 0.1(0.1) 6.1

Buff details

  • buff initial source:T19 4pc
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:27.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114051
  • name:Ascendance
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a $114089r yard range. Stormstrike is empowered and has a $114089r yard range.
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, reducing the cooldown and cost of Stormstrike by {$s4=80}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$s1=30} yd range.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Berserking 2.0 0.0 189.6sec 189.6sec 6.82% 11.42% 0.0(0.0) 2.0

Buff details

  • buff initial source:T19 4pc
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.62% 13.62% 0.0(0.0) 1.0

Buff details

  • buff initial source:T19 4pc
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Chill of the Twisting Nether 1.1 938.8 147.9sec 0.3sec 99.28% 99.33% 938.8(938.8) 0.1

Buff details

  • buff initial source:T19 4pc
  • cooldown name:buff_chill_of_the_twisting_nether
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02

Stack Uptimes

  • chill_of_the_twisting_nether_1:99.28%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:207998
  • name:Chill of the Twisting Nether
  • tooltip:All damage done increased by ${{$s1=15}/10}.1%.
  • description:{$@spelldesc207994=Damaging enemies with your Fire, Frost, or Nature abilities increases all damage you deal by ${{$207995s1=15}/10}.1% for {$207995d=8 seconds}. Each element adds a separate application.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.5sec 25.0sec 32.15% 32.15% 3.1(3.1) 7.9

Buff details

  • buff initial source:T19 4pc
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Doom Winds 5.3 0.0 61.7sec 61.7sec 10.49% 19.19% 0.0(0.0) 5.2

Buff details

  • buff initial source:T19 4pc
  • cooldown name:buff_doom_winds
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • doom_winds_1:10.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:204945
  • name:Doom Winds
  • tooltip:Chance to proc Windfury weapon on auto attacks increased by 100%. Windfury damage increased by {$s2=200}%.
  • description:Unleashes the inner power of the |cFFFFCC99Doomhammer|r, causing all auto attacks to trigger Windfury, and increasing damage dealt by Windfury by {$s2=200}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:60.00
  • default_chance:0.00%
Fire of the Twisting Nether 1.0 1148.3 234.9sec 0.3sec 99.62% 99.69% 1148.3(1148.3) 0.0

Buff details

  • buff initial source:T19 4pc
  • cooldown name:buff_fire_of_the_twisting_nether
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02

Stack Uptimes

  • fire_of_the_twisting_nether_1:99.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:207995
  • name:Fire of the Twisting Nether
  • tooltip:All damage done increased by ${{$s1=15}/10}.1%.
  • description:{$@spelldesc207994=Damaging enemies with your Fire, Frost, or Nature abilities increases all damage you deal by ${{$207995s1=15}/10}.1% for {$207995d=8 seconds}. Each element adds a separate application.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Flametongue 5.1 14.6 59.3sec 15.5sec 98.22% 98.32% 30.2(30.2) 4.1

Buff details

  • buff initial source:T19 4pc
  • cooldown name:buff_flametongue
  • max_stacks:1
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • flametongue_1:98.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194084
  • name:Flametongue
  • tooltip:Each of your weapon attacks causes up to ${$<coeff>*$AP} additional Fire damage.
  • description:{$@spelldesc193796=Scorches your target, dealing {$s2=1} Fire damage, and enhances your weapons with fire for {$194084d=16 seconds}, causing each weapon attack to deal up to ${$<coeff>*$AP} Fire damage, based on weapon speed.}
  • max_stacks:0
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
Frostbrand 7.4 11.5 41.0sec 16.2sec 96.70% 96.99% 45.9(45.9) 6.4

Buff details

  • buff initial source:T19 4pc
  • cooldown name:buff_frostbrand
  • max_stacks:1
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • frostbrand_1:96.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196834
  • name:Frostbrand
  • tooltip:Melee attacks reduce target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
  • description:Chills your target, dealing {$s1=1} Frost damage and reducing the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}, and enhances your weapons with frost for {$d=16 seconds}, causing each weapon attack to reduce the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
  • max_stacks:0
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
Gathering Storms 9.0 1.5 32.3sec 27.3sec 9.44% 6.80% 1.5(1.5) 0.0

Buff details

  • buff initial source:T19 4pc
  • cooldown name:buff_gathering_storms
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • gathering_storms_1:9.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:198300
  • name:Gathering Storms
  • tooltip:Damage of Stormstrike increased by $w1%.
  • description:{$@spelldesc198299=Each target hit by Crash Lightning increases damage dealt by your next Stormstrike within {$198300d=12 seconds} by {$s1=2}%.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Landslide 8.1 48.8 36.7sec 5.2sec 95.88% 89.66% 48.8(48.8) 7.1

Buff details

  • buff initial source:T19 4pc
  • cooldown name:buff_landslide
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • landslide_1:95.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202004
  • name:Landslide
  • tooltip:Agility increased by {$s1=8}%.
  • description:{$@spelldesc197992=$?s201897[Boulderfist][Rockbiter] enhances your weapon, increasing your Agility by {$202004s1=8}% for {$202004d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 104.6sec 0.0sec 40.15% 40.15% 0.0(0.0) 2.0

Buff details

  • buff initial source:T19 4pc
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:40.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Shock of the Twisting Nether 2.2 208.1 115.1sec 1.4sec 99.19% 99.04% 208.1(208.1) 1.2

Buff details

  • buff initial source:T19 4pc
  • cooldown name:buff_shock_of_the_twisting_nether
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02

Stack Uptimes

  • shock_of_the_twisting_nether_1:99.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:207999
  • name:Shock of the Twisting Nether
  • tooltip:All damage done increased by ${{$s1=15}/10}.1%.
  • description:{$@spelldesc207994=Damaging enemies with your Fire, Frost, or Nature abilities increases all damage you deal by ${{$207995s1=15}/10}.1% for {$207995d=8 seconds}. Each element adds a separate application.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 67.9 7.6 4.4sec 3.9sec 21.86% 50.88% 11.9(12.5) 0.0

Buff details

  • buff initial source:T19 4pc
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormbringer_1:21.86%

Trigger Attempt Success

  • trigger_pct:93.89%

Spelldata details

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike has no cooldown and its cost is reduced by {$s3=50}%.
  • description:{$@spelldesc201845=Your weapon attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike, and cause your next Stormstrike to cost {$201846s3=50}% less Maelstrom and trigger no cooldown.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Stormlash 14.1 10.5 21.7sec 12.1sec 50.29% 50.29% 10.5(10.5) 13.6

Buff details

  • buff initial source:T19 4pc
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormlash_1:50.29%

Trigger Attempt Success

  • trigger_pct:99.86%

Spelldata details

  • id:195222
  • name:Stormlash
  • tooltip:Empowered with lightning. Attacks and spellcasts have a chance to deal additional Nature damage.
  • description:{$@spelldesc195255=While your weapons are enhanced, your attacks have a chance to grant Stormlash to up to {$?s210731=false}[${$m1+$210731m1}][{$s1=2}] party or raid members for {$195222d=8 seconds}, causing attacks and spellcasts to deal additional Nature damage.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Unleash Doom 16.2 17.2 18.5sec 8.7sec 46.52% 52.47% 17.2(17.2) 15.7

Buff details

  • buff initial source:T19 4pc
  • cooldown name:buff_unleash_doom
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-0.00

Stack Uptimes

  • unleash_doom_1:46.52%

Trigger Attempt Success

  • trigger_pct:20.07%

Spelldata details

  • id:199055
  • name:Unleash Doom
  • tooltip:Your special attacks will trigger an arc of fiery or lightning damage at your target.
  • description:{$@spelldesc198736=Stormstrike has a chance to unleash the power of |cFFFFCC99Doomhammer|r, causing your special attacks to heave molten lava or lightning spikes at your target for {$199053s1=1} Fire or Nature damage.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Wind Strikes 16.5 59.1 18.4sec 3.9sec 75.05% 79.66% 59.8(63.9) 15.7

Buff details

  • buff initial source:T19 4pc
  • cooldown name:buff_wind_strikes
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.85

Stack Uptimes

  • wind_strikes_1:75.05%

Trigger Attempt Success

  • trigger_pct:93.89%

Spelldata details

  • id:198293
  • name:Wind Strikes
  • tooltip:Attack speed increased by $w1%.
  • description:{$@spelldesc198292=When Stormbringer resets the remaining cooldown on Stormstrike, you gain {$s1=3}% attack speed for {$198293d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
fiery_wolf: Alpha Wolf 1.6 0.5 94.9sec 53.5sec 73.42% 73.42% 7.4(7.4) 0.8

Buff details

  • buff initial source:T19 4pc_fiery_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:73.42%

Trigger Attempt Success

  • trigger_pct:98.67%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
fiery_wolf: Alpha Wolf 1.6 0.8 104.0sec 45.6sec 76.45% 76.45% 8.1(8.1) 0.6

Buff details

  • buff initial source:T19 4pc_fiery_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:76.45%

Trigger Attempt Success

  • trigger_pct:98.52%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
frost_wolf: Alpha Wolf 1.7 0.5 94.9sec 55.4sec 73.75% 73.75% 7.8(7.8) 0.8

Buff details

  • buff initial source:T19 4pc_frost_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:73.75%

Trigger Attempt Success

  • trigger_pct:98.77%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
frost_wolf: Alpha Wolf 1.6 0.9 108.7sec 47.9sec 76.36% 76.36% 8.4(8.4) 0.6

Buff details

  • buff initial source:T19 4pc_frost_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:76.36%

Trigger Attempt Success

  • trigger_pct:98.67%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Alpha Wolf 1.6 0.5 94.2sec 53.3sec 73.71% 73.71% 7.5(7.5) 0.8

Buff details

  • buff initial source:T19 4pc_lightning_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:73.71%

Trigger Attempt Success

  • trigger_pct:98.28%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Alpha Wolf 1.6 0.8 103.1sec 45.4sec 75.93% 75.93% 8.1(8.1) 0.6

Buff details

  • buff initial source:T19 4pc_lightning_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:75.93%

Trigger Attempt Success

  • trigger_pct:98.31%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Crackling Surge 4.1 0.0 22.6sec 22.6sec 76.16% 71.39% 0.0(0.0) 2.7

Buff details

  • buff initial source:T19 4pc_lightning_wolf
  • cooldown name:buff_crackling_surge
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • crackling_surge_1:76.16%

Trigger Attempt Success

  • trigger_pct:99.94%

Spelldata details

  • id:224127
  • name:Crackling Surge
  • tooltip:Damage dealt increased by {$s1=50}%.
  • description:The Doom Wolf surges with electric energy, increasing all damage dealt by {$s1=50}%.
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Crackling Surge 4.1 0.0 22.9sec 22.9sec 76.10% 71.36% 0.0(0.0) 2.7

Buff details

  • buff initial source:T19 4pc_lightning_wolf
  • cooldown name:buff_crackling_surge
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • crackling_surge_1:76.10%

Trigger Attempt Success

  • trigger_pct:99.83%

Spelldata details

  • id:224127
  • name:Crackling Surge
  • tooltip:Damage dealt increased by {$s1=50}%.
  • description:The Doom Wolf surges with electric energy, increasing all damage dealt by {$s1=50}%.
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:T19 4pc
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:T19 4pc
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:T19 4pc
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201639
  • name:Well Fed
  • tooltip:Agility increased by $w1.
  • description:Agility increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Strength of Will

Buff details

  • buff initial source:T19 4pc
  • cooldown name:buff_strength_of_will
  • max_stacks:10
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:304.77

Stack Uptimes

  • strength_of_will_10:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242642
  • name:Strength of Will
  • tooltip:Strength or Agility increased by {$s3=95}, based on your specialization.
  • description:{$@spelldesc242640=While you are above {$s1=80}% health you gain {$242642s3=95} Strength or Agility per second, based on your specialization, stacking up to {$242642u=10} times. If you fall below {$s2=50}% health, this effect is lost.}
  • max_stacks:10
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
Stormbringer: T19 4PC 4.1 53.4sec
Flametongue: Windfury Attack 217.6 2.8sec
Frostbrand: Windfury Attack 215.5 2.8sec
Maelstrom Weapon: Windfury Attack 220.1 2.7sec
Stormbringer: Windfury Attack 13.5 21.9sec
Stormbringer: Windfury Attack Off-Hand 2.9 72.7sec
Flametongue: main_hand 106.1 2.8sec
Frostbrand: main_hand 104.4 2.8sec
Maelstrom Weapon: main_hand 107.8 2.8sec
Stormbringer: main_hand 8.0 31.3sec
Windfury: main_hand 30.5 9.3sec
Flametongue: Windlash 53.4 5.1sec
Frostbrand: Windlash 52.2 5.2sec
Maelstrom Weapon: Windlash 55.0 4.9sec
Stormbringer: Windlash 4.1 53.2sec
Windfury: Windlash 20.8 12.8sec
Flametongue: offhand 105.7 2.8sec
Frostbrand: offhand 104.7 2.8sec
Maelstrom Weapon: offhand 107.4 2.8sec
Stormbringer: offhand 8.0 31.5sec
Windfury: offhand 8.2 25.3sec
Flametongue: Windlash Off-Hand 53.4 5.1sec
Frostbrand: Windlash Off-Hand 52.1 5.2sec
Maelstrom Weapon: Windlash Off-Hand 55.0 4.9sec
Stormbringer: Windlash Off-Hand 4.1 52.5sec
Windfury: Windlash Off-Hand 11.0 21.3sec
Flametongue: Windstrike 67.0 5.0sec
Frostbrand: Windstrike 65.1 5.2sec
Stormbringer: Windstrike 5.2 44.2sec
Windfury: Windstrike 15.5 18.2sec
Unleash Doom (damage): Windstrike 47.9 6.9sec
Flametongue: Windstrike Off-Hand 67.0 5.0sec
Frostbrand: Windstrike Off-Hand 65.1 5.2sec
Stormbringer: Windstrike Off-Hand 5.2 44.5sec
Unleash Doom (damage): Windstrike Off-Hand 47.9 6.9sec
Stormbringer: Rockbiter 4.3 51.7sec
Unleash Doom (damage): Rockbiter 25.7 11.1sec
Flametongue: Crash Lightning 10.5 27.3sec
Frostbrand: Crash Lightning 10.5 27.3sec
Stormbringer: Crash Lightning 0.8 95.0sec
Windfury: Crash Lightning 2.4 69.9sec
Unleash Doom (damage): Crash Lightning 3.4 63.0sec
Stormbringer: Flametongue 1.5 87.0sec
Unleash Doom (damage): Flametongue 9.0 31.2sec
Stormbringer: Frostbrand 1.4 86.5sec
Unleash Doom (damage): Frostbrand 8.3 33.6sec
Flametongue: Stormstrike 97.1 3.6sec
Frostbrand: Stormstrike 97.1 3.6sec
Stormbringer: Stormstrike 7.1 33.4sec
Windfury: Stormstrike 21.8 12.9sec
Unleash Doom (damage): Stormstrike 55.4 6.1sec
Flametongue: Stormstrike Off-Hand 97.1 3.6sec
Frostbrand: Stormstrike Off-Hand 97.1 3.6sec
Stormbringer: Stormstrike Off-Hand 7.3 32.9sec
Unleash Doom (damage): Stormstrike Off-Hand 55.4 6.1sec
Flametongue: Lava Lash 42.2 6.8sec
Frostbrand: Lava Lash 42.2 6.8sec
Stormbringer: Lava Lash 3.2 63.1sec
Unleash Doom (damage): Lava Lash 13.8 19.6sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Windstrike0.7950.0017.90346.5118.68196.278
Feral Spirit1.2050.00123.6012.1690.00023.628
Doom Winds1.7570.00123.8607.3860.83932.866
Ascendance5.3010.18126.7535.4940.18126.753
Rockbiter3.5430.00118.32559.57522.690115.020
Crash Lightning24.4530.001237.747220.8173.075336.855
Flametongue7.1520.00132.092132.79085.848176.468
Stormstrike1.3960.00113.333120.08638.505217.048

Resources

Resource Usage Type Count Total Average RPE APR
T19 4pc
crash_lightning Maelstrom 19.4 388.4 20.0 36.9 9754.2
frostbrand Maelstrom 34.8 695.2 20.0 36.9 52477.4
lava_lash Maelstrom 77.8 2333.1 30.0 55.3 15567.1
stormstrike Maelstrom 179.1 4126.6 23.0 53.1 19706.3
windstrike Maelstrom 127.9 638.8 5.0 11.5 126314.3
Resource Gains Type Count Total Average Overflow
Windfury Attack Maelstrom 405.84 2222.08 (26.62%) 5.48 618.82 21.78%
Main Hand Maelstrom 198.77 959.49 (11.49%) 4.83 34.36 3.46%
Windlash Maelstrom 101.42 383.49 (4.59%) 3.78 123.64 24.38%
Off-Hand Maelstrom 197.94 952.22 (11.41%) 4.81 37.49 3.79%
Windlash Off-Hand Maelstrom 101.46 379.10 (4.54%) 3.74 128.21 25.27%
Feral Spirit Maelstrom 184.32 599.39 (7.18%) 3.25 322.22 34.96%
Rockbiter Maelstrom 104.88 2851.33 (34.16%) 27.19 190.12 6.25%
Resource RPS-Gain RPS-Loss
Maelstrom 15.10 14.80
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 89.01 0.00 150.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data T19 4pc Fight Length
Count 2497
Mean 299.78
Minimum 199.68
Maximum 400.06
Spread ( max - min ) 200.38
Range [ ( max - min ) / 2 * 100% ] 33.42%
Standard Deviation 42.3408
5th Percentile 233.53
95th Percentile 368.53
( 95th Percentile - 5th Percentile ) 135.00
Mean Distribution
Standard Deviation 0.8473
95.00% Confidence Intervall ( 298.12 - 301.44 )
Normalized 95.00% Confidence Intervall ( 99.45% - 100.55% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 767
0.1% Error 76631
0.1 Scale Factor Error with Delta=300 16
0.05 Scale Factor Error with Delta=300 62
0.01 Scale Factor Error with Delta=300 1531
DPS
Sample Data T19 4pc Damage Per Second
Count 2497
Mean 1334268.53
Minimum 1098358.57
Maximum 1639980.34
Spread ( max - min ) 541621.78
Range [ ( max - min ) / 2 * 100% ] 20.30%
Standard Deviation 74610.1219
5th Percentile 1221239.50
95th Percentile 1467015.68
( 95th Percentile - 5th Percentile ) 245776.18
Mean Distribution
Standard Deviation 1493.0986
95.00% Confidence Intervall ( 1331342.11 - 1337194.95 )
Normalized 95.00% Confidence Intervall ( 99.78% - 100.22% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 121
0.1% Error 12012
0.1 Scale Factor Error with Delta=300 47520300
0.05 Scale Factor Error with Delta=300 190081198
0.01 Scale Factor Error with Delta=300 4752029937
Priority Target DPS
Sample Data T19 4pc Priority Target Damage Per Second
Count 2497
Mean 1334415.95
Minimum 1113316.88
Maximum 1630927.52
Spread ( max - min ) 517610.64
Range [ ( max - min ) / 2 * 100% ] 19.39%
Standard Deviation 73685.0008
5th Percentile 1222094.73
95th Percentile 1464545.59
( 95th Percentile - 5th Percentile ) 242450.86
Mean Distribution
Standard Deviation 1474.5850
95.00% Confidence Intervall ( 1331525.81 - 1337306.08 )
Normalized 95.00% Confidence Intervall ( 99.78% - 100.22% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 118
0.1% Error 11714
0.1 Scale Factor Error with Delta=300 46349159
0.05 Scale Factor Error with Delta=300 185396634
0.01 Scale Factor Error with Delta=300 4634915847
DPS(e)
Sample Data T19 4pc Damage Per Second (Effective)
Count 2497
Mean 1334268.53
Minimum 1098358.57
Maximum 1639980.34
Spread ( max - min ) 541621.78
Range [ ( max - min ) / 2 * 100% ] 20.30%
Damage
Sample Data T19 4pc Damage
Count 2497
Mean 386077310.53
Minimum 308005838.06
Maximum 468893983.96
Spread ( max - min ) 160888145.90
Range [ ( max - min ) / 2 * 100% ] 20.84%
DTPS
Sample Data T19 4pc Damage Taken Per Second
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data T19 4pc Healing Per Second
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data T19 4pc Healing Per Second (Effective)
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data T19 4pc Heal
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data T19 4pc Healing Taken Per Second
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data T19 4pc Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data T19 4pcTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data T19 4pc Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 potion
5 0.00 lightning_shield
Default action list Executed every time the actor is available.
# count action,conditions
0.00 wind_shear
0.00 variable,name=hailstormCheck,value=((talent.hailstorm.enabled&!buff.frostbrand.up)|!talent.hailstorm.enabled)
0.00 variable,name=furyCheck80,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>80))
0.00 variable,name=furyCheck70,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>70))
0.00 variable,name=furyCheck45,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>45))
0.00 variable,name=furyCheck25,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>25))
0.00 variable,name=OCPool70,value=(!talent.overcharge.enabled|(talent.overcharge.enabled&maelstrom>70))
0.00 variable,name=OCPool60,value=(!talent.overcharge.enabled|(talent.overcharge.enabled&maelstrom>60))
0.00 variable,name=heartEquipped,value=(equipped.151819)
0.00 variable,name=akainuEquipped,value=(equipped.137084)
0.00 variable,name=akainuAS,value=(variable.akainuEquipped&buff.hot_hand.react&!buff.frostbrand.up)
0.00 variable,name=LightningCrashNotUp,value=(!buff.lightning_crash.up&set_bonus.tier20_2pc)
0.00 variable,name=alphaWolfCheck,value=((pet.frost_wolf.buff.alpha_wolf.remains<2&pet.fiery_wolf.buff.alpha_wolf.remains<2&pet.lightning_wolf.buff.alpha_wolf.remains<2)&feral_spirit.remains>4)
6 1.00 auto_attack
7 7.16 use_items
8 0.00 call_action_list,name=opener
9 55.47 windstrike,if=(variable.heartEquipped|set_bonus.tier19_2pc)&(!talent.earthen_spike.enabled|(cooldown.earthen_spike.remains>1&cooldown.doom_winds.remains>1)|debuff.earthen_spike.up)
A 0.00 call_action_list,name=buffs
B 0.00 call_action_list,name=CDs
C 0.00 call_action_list,name=core
D 0.00 call_action_list,name=filler
actions.CDs
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
E 2.03 berserking,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
0.00 blood_fury,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
F 1.00 potion,if=buff.ascendance.up|!talent.ascendance.enabled&feral_spirit.remains>5|target.time_to_die<=60
G 2.97 feral_spirit
H 5.32 doom_winds,if=debuff.earthen_spike.up&talent.earthen_spike.enabled|!talent.earthen_spike.enabled
I 2.04 ascendance,if=buff.doom_winds.up
actions.buffs
# count action,conditions
J 7.23 rockbiter,if=talent.landslide.enabled&!buff.landslide.up
0.00 fury_of_air,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
K 2.57 crash_lightning,if=artifact.alpha_wolf.rank&prev_gcd.1.feral_spirit
L 5.06 flametongue,if=!buff.flametongue.up
M 7.35 frostbrand,if=talent.hailstorm.enabled&!buff.frostbrand.up&variable.furyCheck45
N 2.38 flametongue,if=buff.flametongue.remains<6+gcd&cooldown.doom_winds.remains<gcd*2
O 2.67 frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<6+gcd&cooldown.doom_winds.remains<gcd*2
actions.core
# count action,conditions
0.00 earthen_spike,if=variable.furyCheck25
0.00 crash_lightning,if=!buff.crash_lightning.up&active_enemies>=2
0.00 windsong
0.00 crash_lightning,if=active_enemies>=8|(active_enemies>=6&talent.crashing_storm.enabled)
0.00 windstrike
P 43.52 stormstrike,if=buff.stormbringer.up&variable.furyCheck25
0.00 crash_lightning,if=active_enemies>=4|(active_enemies>=2&talent.crashing_storm.enabled)
0.00 lightning_bolt,if=talent.overcharge.enabled&variable.furyCheck45&maelstrom>=40
Q 34.20 stormstrike,if=(!talent.overcharge.enabled&variable.furyCheck45)|(talent.overcharge.enabled&variable.furyCheck80)
0.00 frostbrand,if=variable.akainuAS
0.00 lava_lash,if=buff.hot_hand.react&((variable.akainuEquipped&buff.frostbrand.up)|!variable.akainuEquipped)
0.00 sundering,if=active_enemies>=3
R 2.23 crash_lightning,if=active_enemies>=3|variable.LightningCrashNotUp|variable.alphaWolfCheck
actions.filler
# count action,conditions
S 48.82 rockbiter,if=maelstrom<120
T 10.23 flametongue,if=buff.flametongue.remains<4.8
0.00 rockbiter,if=maelstrom<=40
0.00 crash_lightning,if=(talent.crashing_storm.enabled|active_enemies>=2)&debuff.earthen_spike.up&maelstrom>=40&variable.OCPool60
U 8.83 frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<4.8&maelstrom>40
0.00 frostbrand,if=variable.akainuEquipped&!buff.frostbrand.up&maelstrom>=75
0.00 sundering
V 42.18 lava_lash,if=maelstrom>=50&variable.OCPool70&variable.furyCheck80
0.00 rockbiter
W 5.73 crash_lightning,if=(maelstrom>=65|talent.crashing_storm.enabled|active_enemies>=2)&variable.OCPool60&variable.furyCheck45
X 2.04 flametongue
actions.opener
# count action,conditions
Y 0.83 rockbiter,if=maelstrom<15&time<2

Sample Sequence

012467YLMGKEHI999V9V99999J9T9U9V9V9V99J9V9V9SPPQSTUV99S9V9V99S7QSPQLMPQSSVVSVVTOQHPQPQJPPPQSSPQPQLMPQSPPS7QSVTSPQWMSVWSVPWSQFT99S99M99Q99N9999J9OGKHP7PQVPJQPPLQUPQSSVVPQPQSSLUSVVPQSVWSTVVSUQW7PSPQSPWTSQWOHI9999EV99J99999999LQJMVSPQSVPPQP7QLSSMVSVVVQSTV99S9U9SQSVNGKOHVPPQJRVVP

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask T19 4pc 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom
Pre precombat 1 food T19 4pc 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom
Pre precombat 2 augmentation T19 4pc 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom potion_of_prolonged_power
0:00.000 default 6 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom potion_of_prolonged_power
0:00.000 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/150: 3% maelstrom potion_of_prolonged_power
0:00.000 opener Y rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/150: 3% maelstrom potion_of_prolonged_power
0:01.105 buffs L flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/150: 23% maelstrom bloodlust, landslide, shock_of_the_twisting_nether, potion_of_prolonged_power
0:01.956 buffs M frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/150: 26% maelstrom bloodlust, flametongue, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, potion_of_prolonged_power
0:02.807 CDs G feral_spirit Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/150: 16% maelstrom bloodlust, flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:03.657 buffs K crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/150: 26% maelstrom bloodlust, flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:04.509 CDs E berserking Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/150: 35% maelstrom bloodlust, flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:04.509 CDs H doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/150: 35% maelstrom bloodlust, berserking, flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:04.509 CDs I ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/150: 35% maelstrom bloodlust, berserking, flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, gathering_storms, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:04.509 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/150: 35% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, gathering_storms, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:05.265 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/150: 61% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:06.019 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:06.775 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:07.529 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:08.282 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:09.036 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 149.0/150: 99% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:09.790 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:10.545 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:11.300 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, stormbringer, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:12.054 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:12.808 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:13.564 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:14.318 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:15.073 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:15.968 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:16.819 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 145.0/150: 97% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, unleash_doom, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:17.671 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, unleash_doom, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:18.523 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, unleash_doom, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:19.375 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 141.0/150: 94% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, unleash_doom, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:20.226 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/150: 77% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:21.078 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 141.0/150: 94% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:21.930 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/150: 77% maelstrom bloodlust, ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:22.782 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/150: 81% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:23.635 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 133.0/150: 89% maelstrom bloodlust, ascendance, flametongue, frostbrand, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:24.486 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:25.338 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:26.187 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:27.038 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/150: 81% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:27.889 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/150: 77% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:28.740 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/150: 75% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, unleash_doom, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:29.594 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 147.0/150: 98% maelstrom bloodlust, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:30.447 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 141.0/150: 94% maelstrom bloodlust, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:31.300 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:32.151 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/150: 79% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:33.003 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:33.854 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:34.705 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:35.556 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom bloodlust, ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:36.407 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/150: 77% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:37.258 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/150: 75% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:38.108 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:38.960 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:39.813 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:40.664 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 127.0/150: 85% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:41.515 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/150: 68% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:42.623 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/150: 69% maelstrom ascendance, flametongue, frostbrand, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:43.728 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom ascendance, flametongue, frostbrand, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:44.833 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 139.0/150: 93% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:44.833 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 139.0/150: 93% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:45.938 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/150: 73% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:47.045 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 143.0/150: 95% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:48.151 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 137.0/150: 91% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:49.257 buffs L flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/150: 71% maelstrom frostbrand, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:50.363 buffs M frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/150: 75% maelstrom flametongue, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:51.469 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/150: 74% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:52.575 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:53.682 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:54.786 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/150: 73% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:55.891 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 148.0/150: 99% maelstrom flametongue, frostbrand, landslide, unleash_doom, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:56.996 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/150: 82% maelstrom flametongue, frostbrand, landslide, unleash_doom, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:58.102 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/150: 65% maelstrom flametongue, frostbrand, landslide, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
0:59.207 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 132.0/150: 88% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:00.311 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/150: 81% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:01.417 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:02.524 buffs O frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:03.630 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:04.734 CDs H doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:04.734 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:05.837 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/150: 46% maelstrom flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:06.943 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/150: 32% maelstrom flametongue, frostbrand, stormbringer, landslide, doom_winds, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:08.048 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/150: 31% maelstrom flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:09.156 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/150: 17% maelstrom flametongue, frostbrand, doom_winds, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:10.263 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/150: 49% maelstrom flametongue, frostbrand, stormbringer, landslide, doom_winds, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:11.368 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/150: 58% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:12.472 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/150: 48% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:13.578 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/150: 44% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:14.683 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/150: 49% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:15.789 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/150: 71% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:16.896 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 136.0/150: 91% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:18.002 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 126.0/150: 84% maelstrom flametongue, frostbrand, landslide, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:19.108 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:20.216 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:21.320 buffs L flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom frostbrand, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:22.424 buffs M frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:23.529 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/150: 43% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:24.636 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/150: 36% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:25.742 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/150: 9% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:26.848 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/150: 35% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:27.954 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/150: 22% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:29.060 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/150: 12% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:30.167 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/150: 38% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:30.167 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/150: 38% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:31.271 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/150: 24% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:32.378 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:33.484 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, landslide, unleash_doom, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:34.590 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, landslide, unleash_doom, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:35.695 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/150: 53% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:36.799 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/150: 43% maelstrom flametongue, frostbrand, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:37.905 filler W crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/150: 19% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:39.010 buffs M frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/150: 19% maelstrom flametongue, stormbringer, landslide, wind_strikes, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:40.117 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/150: 21% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:41.221 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/150: 44% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:42.327 filler W crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/150: 27% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:43.432 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, stormbringer, landslide, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:44.538 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/150: 53% maelstrom flametongue, frostbrand, stormbringer, landslide, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:45.644 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/150: 36% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:46.750 filler W crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/150: 26% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:47.855 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/150: 16% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:48.960 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/150: 39% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:50.064 CDs F potion Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/150: 19% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:50.064 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/150: 19% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:51.168 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/150: 22% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:52.274 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/150: 23% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:53.378 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:54.486 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/150: 56% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:55.592 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/150: 66% maelstrom ascendance, flametongue, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:56.698 buffs M frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/150: 67% maelstrom ascendance, flametongue, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:57.804 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/150: 57% maelstrom ascendance, flametongue, frostbrand, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:58.909 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/150: 59% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:00.014 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/150: 59% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:01.119 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/150: 36% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:02.224 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/150: 49% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:03.329 buffs N flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:04.434 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom ascendance, flametongue, frostbrand, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:05.539 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/150: 71% maelstrom ascendance, flametongue, frostbrand, stormbringer, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:06.646 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/150: 81% maelstrom ascendance, flametongue, frostbrand, stormbringer, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:07.753 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/150: 81% maelstrom ascendance, flametongue, frostbrand, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:08.858 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/150: 83% maelstrom ascendance, flametongue, frostbrand, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:09.963 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:11.068 buffs O frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:12.174 CDs G feral_spirit Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:13.280 buffs K crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:14.385 CDs H doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:14.385 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, gathering_storms, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:15.490 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:15.490 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:16.595 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, doom_winds, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:17.702 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, doom_winds, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:18.807 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:19.914 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, doom_winds, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:21.019 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:22.126 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 139.0/150: 93% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:23.232 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:24.339 buffs L flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom frostbrand, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:25.445 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:26.551 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:27.657 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:28.761 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/150: 83% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:29.868 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/150: 59% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:30.973 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/150: 79% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:32.078 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:33.183 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 139.0/150: 93% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:34.289 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/150: 76% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:35.394 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/150: 69% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:36.499 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/150: 46% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:37.604 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/150: 36% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:38.710 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/150: 13% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:39.817 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/150: 35% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:40.923 buffs L flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/150: 58% maelstrom frostbrand, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:42.028 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/150: 65% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:43.133 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/150: 55% maelstrom flametongue, frostbrand, landslide, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:44.239 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/150: 77% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:45.344 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/150: 61% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:46.449 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/150: 47% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:47.556 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/150: 37% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:48.661 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/150: 14% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:49.767 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:50.871 filler W crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:51.977 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/150: 19% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:53.082 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/150: 42% maelstrom flametongue, frostbrand, landslide, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:54.188 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/150: 45% maelstrom flametongue, frostbrand, landslide, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:55.296 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/150: 38% maelstrom flametongue, frostbrand, landslide, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:56.401 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/150: 18% maelstrom flametongue, frostbrand, landslide, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:57.506 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, landslide, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:58.614 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, landslide, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:59.719 filler W crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:00.826 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/150: 16% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:00.826 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/150: 16% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:01.931 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/150: 6% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:03.034 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/150: 32% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:04.138 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/150: 31% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:05.242 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/150: 8% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:06.348 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/150: 34% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:07.454 filler W crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/150: 21% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:08.559 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/150: 11% maelstrom flametongue, frostbrand, landslide, wind_strikes, gathering_storms, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:09.664 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/150: 14% maelstrom flametongue, frostbrand, landslide, wind_strikes, gathering_storms, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:10.769 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/150: 46% maelstrom flametongue, frostbrand, landslide, wind_strikes, gathering_storms, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:11.875 filler W crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/150: 23% maelstrom flametongue, frostbrand, landslide, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:12.980 Waiting     0.500 sec 220000.0/220000: 100% mana | 19.0/150: 13% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:13.480 buffs O frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/150: 16% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:14.586 CDs H doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/150: 6% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:14.586 CDs I ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/150: 6% maelstrom flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, gathering_storms, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:14.586 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/150: 6% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, gathering_storms, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:15.690 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/150: 16% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:16.796 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/150: 48% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:17.901 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/150: 67% maelstrom ascendance, flametongue, frostbrand, landslide, doom_winds, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:19.007 CDs E berserking Fluffy_Pillow 220000.0/220000: 100% mana | 126.0/150: 84% maelstrom ascendance, flametongue, frostbrand, landslide, doom_winds, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:19.007 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 126.0/150: 84% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:19.969 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 134.0/150: 89% maelstrom berserking, ascendance, flametongue, frostbrand, stormbringer, doom_winds, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, chill_of_the_twisting_nether
3:20.931 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 149.0/150: 99% maelstrom berserking, ascendance, flametongue, frostbrand, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, chill_of_the_twisting_nether
3:21.892 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 146.0/150: 97% maelstrom berserking, ascendance, flametongue, frostbrand, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, chill_of_the_twisting_nether
3:22.854 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:23.814 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom berserking, ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:24.775 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom berserking, ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:25.735 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:26.697 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom berserking, ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:27.657 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:28.615 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom berserking, ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:29.577 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:30.682 buffs L flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 147.0/150: 98% maelstrom frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:31.789 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:32.894 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:33.999 buffs M frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 149.0/150: 99% maelstrom flametongue, landslide, unleash_doom, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:35.105 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 129.0/150: 86% maelstrom flametongue, frostbrand, landslide, unleash_doom, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:36.213 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/150: 69% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:37.319 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:38.425 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:39.530 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/150: 73% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:40.635 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 143.0/150: 95% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:41.741 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 137.0/150: 91% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:42.847 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 136.0/150: 91% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:43.954 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/150: 81% maelstrom flametongue, frostbrand, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:45.059 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:46.164 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:46.164 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:47.271 buffs L flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/150: 46% maelstrom frostbrand, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:48.378 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/150: 49% maelstrom flametongue, frostbrand, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:49.483 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/150: 72% maelstrom flametongue, frostbrand, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:50.590 buffs M frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 137.0/150: 91% maelstrom flametongue, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:51.697 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/150: 81% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:52.803 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/150: 65% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:53.908 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 131.0/150: 87% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:55.014 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/150: 67% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:56.119 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/150: 51% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:57.223 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:58.329 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom ascendance, flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:59.433 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/150: 46% maelstrom ascendance, flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:00.537 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/150: 49% maelstrom ascendance, flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:01.643 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/150: 33% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:02.748 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/150: 55% maelstrom ascendance, flametongue, frostbrand, landslide, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:03.852 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom ascendance, flametongue, frostbrand, landslide, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:04.957 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 128.0/150: 85% maelstrom ascendance, flametongue, frostbrand, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:06.063 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom ascendance, flametongue, frostbrand, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:07.168 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom ascendance, flametongue, frostbrand, landslide, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:08.272 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/150: 75% maelstrom flametongue, frostbrand, landslide, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:09.379 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 146.0/150: 97% maelstrom flametongue, frostbrand, landslide, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:10.485 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/150: 77% maelstrom flametongue, frostbrand, landslide, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:11.591 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:12.698 buffs N flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:13.804 CDs G feral_spirit Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:14.911 buffs K crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 145.0/150: 97% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:16.017 buffs O frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 149.0/150: 99% maelstrom flametongue, frostbrand, landslide, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:17.121 CDs H doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 149.0/150: 99% maelstrom flametongue, frostbrand, landslide, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:17.121 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 149.0/150: 99% maelstrom flametongue, frostbrand, landslide, doom_winds, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:18.226 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 148.0/150: 99% maelstrom flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:19.331 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 138.0/150: 92% maelstrom flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:20.437 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 147.0/150: 98% maelstrom flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:21.542 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 136.0/150: 91% maelstrom flametongue, frostbrand, doom_winds, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:22.648 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:23.754 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:24.860 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom flametongue, frostbrand, landslide, unleash_doom, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:25.964 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4728 4403 0
Agility 44332 38901 28018 (24626)
Stamina 81377 81377 45295
Intellect 7649 7324 0
Spirit 1 1 0
Health 4882620 4882620 0
Mana 220000 220000 0
Maelstrom 150 150 0
Spell Power 53198 46681 0
Crit 18.60% 18.60% 3439
Haste 36.17% 36.17% 13565
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 44332 38901 0
Mastery 60.58% 60.58% 8916
Armor 3282 3282 3282
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 939.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of the Skybreaker
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +871 Crit, +515 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Flesh-Raking Leggings
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Mastery }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }, gems: { +150 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Eye of the Twisting Nether
ilevel: 970, stats: { +3515 Sta, +2884 Haste, +1602 Mastery }, gems: { +200 Agi }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Specter of Betrayal
ilevel: 940, stats: { +2994 StrAgi }
Local Trinket2 Cradle of Anguish
ilevel: 930, stats: { +1320 Haste }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Agi }
Local Main Hand Doomhammer
ilevel: 951, weapon: { 8445 - 15685, 2.6 }, stats: { +1496 Agi, +2244 Sta, +435 Crit, +418 Mastery }, relics: { +67 ilevels, +67 ilevels, +67 ilevels }
Local Off Hand Fury of the Stonemother
ilevel: 951, weapon: { 8445 - 15685, 2.6 }, stats: { +1496 Agi, +2244 Sta, +435 Crit, +418 Mastery }

Talents

Level
15 Windsong (Enhancement Shaman) Hot Hand (Enhancement Shaman) Landslide (Enhancement Shaman)
30 Rainfall (Enhancement Shaman) Feral Lunge (Enhancement Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Lightning Shield (Enhancement Shaman) Ancestral Swiftness Hailstorm (Enhancement Shaman)
75 Tempest (Enhancement Shaman) Overcharge (Enhancement Shaman) Empowered Stormlash (Enhancement Shaman)
90 Crashing Storm (Enhancement Shaman) Fury of Air (Enhancement Shaman) Sundering (Enhancement Shaman)
100 Ascendance (Enhancement Shaman) Boulderfist (Enhancement Shaman) Earthen Spike (Enhancement Shaman)

Profile

shaman="T19 4pc"
spec=enhancement
level=110
race=troll
role=attack
position=back
talents=3133111
artifact=41:0:0:0:0:899:1:900:1:901:1:902:1:903:1:904:1:905:4:906:4:907:4:908:4:909:4:910:4:911:4:912:4:913:4:930:1:1351:1:1388:1:1593:4:1594:1:1595:1:1596:1:1687:1

# Default consumables
potion=prolonged_power
flask=seventh_demon
food=lavish_suramar_feast
augmentation=defiled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/lightning_shield

# Executed every time the actor is available.
actions=wind_shear
actions+=/variable,name=hailstormCheck,value=((talent.hailstorm.enabled&!buff.frostbrand.up)|!talent.hailstorm.enabled)
actions+=/variable,name=furyCheck80,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>80))
actions+=/variable,name=furyCheck70,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>70))
actions+=/variable,name=furyCheck45,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>45))
actions+=/variable,name=furyCheck25,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>25))
actions+=/variable,name=OCPool70,value=(!talent.overcharge.enabled|(talent.overcharge.enabled&maelstrom>70))
actions+=/variable,name=OCPool60,value=(!talent.overcharge.enabled|(talent.overcharge.enabled&maelstrom>60))
actions+=/variable,name=heartEquipped,value=(equipped.151819)
actions+=/variable,name=akainuEquipped,value=(equipped.137084)
actions+=/variable,name=akainuAS,value=(variable.akainuEquipped&buff.hot_hand.react&!buff.frostbrand.up)
actions+=/variable,name=LightningCrashNotUp,value=(!buff.lightning_crash.up&set_bonus.tier20_2pc)
actions+=/variable,name=alphaWolfCheck,value=((pet.frost_wolf.buff.alpha_wolf.remains<2&pet.fiery_wolf.buff.alpha_wolf.remains<2&pet.lightning_wolf.buff.alpha_wolf.remains<2)&feral_spirit.remains>4)
actions+=/auto_attack
actions+=/use_items
actions+=/call_action_list,name=opener
actions+=/windstrike,if=(variable.heartEquipped|set_bonus.tier19_2pc)&(!talent.earthen_spike.enabled|(cooldown.earthen_spike.remains>1&cooldown.doom_winds.remains>1)|debuff.earthen_spike.up)
actions+=/call_action_list,name=buffs
actions+=/call_action_list,name=CDs
actions+=/call_action_list,name=core
actions+=/call_action_list,name=filler

actions.CDs=bloodlust,if=target.health.pct<25|time>0.500
actions.CDs+=/berserking,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
actions.CDs+=/blood_fury,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
actions.CDs+=/potion,if=buff.ascendance.up|!talent.ascendance.enabled&feral_spirit.remains>5|target.time_to_die<=60
actions.CDs+=/feral_spirit
actions.CDs+=/doom_winds,if=debuff.earthen_spike.up&talent.earthen_spike.enabled|!talent.earthen_spike.enabled
actions.CDs+=/ascendance,if=buff.doom_winds.up

actions.buffs=rockbiter,if=talent.landslide.enabled&!buff.landslide.up
actions.buffs+=/fury_of_air,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
actions.buffs+=/crash_lightning,if=artifact.alpha_wolf.rank&prev_gcd.1.feral_spirit
actions.buffs+=/flametongue,if=!buff.flametongue.up
actions.buffs+=/frostbrand,if=talent.hailstorm.enabled&!buff.frostbrand.up&variable.furyCheck45
actions.buffs+=/flametongue,if=buff.flametongue.remains<6+gcd&cooldown.doom_winds.remains<gcd*2
actions.buffs+=/frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<6+gcd&cooldown.doom_winds.remains<gcd*2

actions.core=earthen_spike,if=variable.furyCheck25
actions.core+=/crash_lightning,if=!buff.crash_lightning.up&active_enemies>=2
actions.core+=/windsong
actions.core+=/crash_lightning,if=active_enemies>=8|(active_enemies>=6&talent.crashing_storm.enabled)
actions.core+=/windstrike
actions.core+=/stormstrike,if=buff.stormbringer.up&variable.furyCheck25
actions.core+=/crash_lightning,if=active_enemies>=4|(active_enemies>=2&talent.crashing_storm.enabled)
actions.core+=/lightning_bolt,if=talent.overcharge.enabled&variable.furyCheck45&maelstrom>=40
actions.core+=/stormstrike,if=(!talent.overcharge.enabled&variable.furyCheck45)|(talent.overcharge.enabled&variable.furyCheck80)
actions.core+=/frostbrand,if=variable.akainuAS
actions.core+=/lava_lash,if=buff.hot_hand.react&((variable.akainuEquipped&buff.frostbrand.up)|!variable.akainuEquipped)
actions.core+=/sundering,if=active_enemies>=3
actions.core+=/crash_lightning,if=active_enemies>=3|variable.LightningCrashNotUp|variable.alphaWolfCheck

actions.filler=rockbiter,if=maelstrom<120
actions.filler+=/flametongue,if=buff.flametongue.remains<4.8
actions.filler+=/rockbiter,if=maelstrom<=40
actions.filler+=/crash_lightning,if=(talent.crashing_storm.enabled|active_enemies>=2)&debuff.earthen_spike.up&maelstrom>=40&variable.OCPool60
actions.filler+=/frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<4.8&maelstrom>40
actions.filler+=/frostbrand,if=variable.akainuEquipped&!buff.frostbrand.up&maelstrom>=75
actions.filler+=/sundering
actions.filler+=/lava_lash,if=maelstrom>=50&variable.OCPool70&variable.furyCheck80
actions.filler+=/rockbiter
actions.filler+=/crash_lightning,if=(maelstrom>=65|talent.crashing_storm.enabled|active_enemies>=2)&variable.OCPool60&variable.furyCheck45
actions.filler+=/flametongue

actions.opener=rockbiter,if=maelstrom<15&time<2

head=helmet_of_the_skybreaker,id=147178,bonus_id=1512/3563
neck=string_of_extracted_incisors,id=147013,bonus_id=1512/3563,enchant_id=5439
shoulders=pauldrons_of_the_skybreaker,id=147180,bonus_id=1512/3563
back=drape_of_the_skybreaker,id=147176,bonus_id=1512/3563,enchant_id=5435
chest=harness_of_the_skybreaker,id=147175,bonus_id=1512/3563
wrists=painsinged_armguards,id=147057,bonus_id=1512/3563
hands=smoldering_heart,id=151819,bonus_id=3570
waist=waistguard_of_interminable_unity,id=147056,bonus_id=1512/3563
legs=fleshraking_leggings,id=147051,bonus_id=1512/3563
feet=starstalker_treads,id=147046,bonus_id=1522/3563,gem_id=130222
finger1=eye_of_the_twisting_nether,id=137050,bonus_id=3570,gem_id=130247,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,bonus_id=1512/3563,enchant=200haste
trinket1=specter_of_betrayal,id=151190,bonus_id=1522/3563
trinket2=cradle_of_anguish,id=147010,bonus_id=1512/3563
main_hand=doomhammer,id=128819,bonus_id=745,gem_id=147088/147100/147115,relic_id=1512:3563/1512:3563/1512:3563
off_hand=fury_of_the_stonemother,id=128873,gem_id=0/0/0/0,relic_id=0/0

# Gear Summary
# gear_ilvl=938.88
# gear_agility=28018
# gear_stamina=45295
# gear_crit_rating=3439
# gear_haste_rating=13565
# gear_mastery_rating=8916
# gear_versatility_rating=2624
# gear_armor=3282
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1

T19 4pc - T20 2pc : 1372489 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1372489.1 1372489.1 2840.5 / 0.207% 279968.9 / 20.4% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.37% 60.6 100.1% 100%
Talents
  • 15: Landslide (Enhancement Shaman)
  • 30: Rainfall (Enhancement Shaman)
  • 45: Voodoo Totem
  • 60: Hailstorm (Enhancement Shaman)
  • 75: Tempest (Enhancement Shaman)
  • 90: Crashing Storm (Enhancement Shaman)
  • 100: Ascendance (Enhancement Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
T19 4pc - T20 2pc 1372489
Crash Lightning 15641 (25361) 1.1% (1.9%) 20.7 14.55sec 368827 348436 Direct 20.7 189109 378112 227481 20.3% 0.0%  

Stats details: crash_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.74 20.74 0.00 0.00 1.0585 0.0000 4718007.71 4718007.71 0.00 348435.77 348435.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.53 79.69% 189109.32 179239 202409 189190.76 184352 195976 3125480 3125480 0.00
crit 4.21 20.31% 378111.96 358479 404819 375060.87 0 404819 1592528 1592528 0.00
 
 

Action details: crash_lightning

Static Values
  • id:187874
  • school:nature
  • resource:maelstrom
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:artifact.alpha_wolf.rank&prev_gcd.1.feral_spirit
Spelldata
  • id:187874
  • name:Crash Lightning
  • school:nature
  • tooltip:Stormstrike and Lava Lash deal an additional $195592sw1 damage to all targets in front of you.
  • description:Electrocutes all enemies in front of you, dealing $sw1 Nature damage. Hitting 2 or more targets enhances your weapons for {$187878d=10 seconds}, causing Stormstrike and Lava Lash to also deal $195592sw1 Nature damage to all targets in front of you.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.50
 
    Crashing Storm 9720 0.7% 143.8 2.04sec 20384 0 Direct 143.8 16483 32975 20385 23.7% 0.0%  

Stats details: crashing_storm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 143.80 143.80 0.00 0.00 0.0000 0.0000 2931202.75 2931202.75 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 109.78 76.34% 16482.86 14519 18094 16491.56 16078 17108 1809468 1809468 0.00
crit 34.02 23.66% 32975.14 29037 36187 32991.65 31943 34835 1121735 1121735 0.00
 
 

Action details: crashing_storm

Static Values
  • id:210801
  • school:nature
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210801
  • name:Crashing Storm
  • school:nature
  • tooltip:
  • description:{$@spelldesc192246=Crash Lightning also electrifies the ground, leaving an electrical field behind which damages enemies within it for ${7*{$210801s1=1}} Nature damage over {$210797d=6 seconds}. }
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.160000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Dread Torrent 40557 3.0% 53.0 10.60sec 230199 0 Direct 53.0 187682 375442 230198 22.6% 0.0%  

Stats details: dread_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.00 53.00 0.00 0.00 0.0000 0.0000 12200436.31 12200436.31 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.00 77.36% 187682.43 182405 187918 187677.50 187162 187918 7694683 7694683 0.00
crit 12.00 22.64% 375441.93 364809 375836 375288.76 0 375836 4505753 4505753 0.00
 
 

Action details: dread_torrent

Static Values
  • id:246464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246464
  • name:Dread Torrent
  • school:shadow
  • tooltip:
  • description:{$@spelldesc246461=Create a Dread Reflection at your location for {$d=60 seconds} and cause each of your Dread Reflections to unleash a torrent of magic that deals ${{$246464s1=39731 to 43913}*4} Shadow damage over {$246463d=3 seconds}, split evenly among nearby enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:140074.50
  • base_dd_max:154819.18
 
Flametongue 15383 (68910) 1.1% (5.0%) 19.5 15.71sec 1057535 997316 Direct 19.5 192216 384372 236810 23.2% 0.0%  

Stats details: flametongue

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.54 19.54 0.00 0.00 1.0604 0.0000 4625547.71 4625547.71 0.00 997316.29 997316.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.01 76.81% 192215.67 179999 210826 192295.87 185404 200380 2884211 2884211 0.00
crit 4.53 23.19% 384372.47 359999 421651 381928.20 0 421651 1741336 1741336 0.00
 
 

Action details: flametongue

Static Values
  • id:193796
  • school:fire
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!buff.flametongue.up
Spelldata
  • id:193796
  • name:Flametongue
  • school:fire
  • tooltip:
  • description:Scorches your target, dealing {$s2=1} Fire damage, and enhances your weapons with fire for {$194084d=16 seconds}, causing each weapon attack to deal up to ${$<coeff>*$AP} Fire damage, based on weapon speed.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Flametongue Attack 53527 3.9% 919.2 0.59sec 17443 0 Direct 919.2 14182 28371 17443 23.0% 0.0%  

Stats details: flametongue_attack

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 919.24 919.24 0.00 0.00 0.0000 0.0000 16033859.27 16033859.27 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 707.97 77.02% 14181.61 12111 15550 14186.45 13839 14573 10040131 10040131 0.00
crit 211.27 22.98% 28370.68 24586 31099 28380.76 27726 29209 5993728 5993728 0.00
 
 

Action details: flametongue_attack

Static Values
  • id:10444
  • school:fire
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:{$@spelldesc193796=Scorches your target, dealing {$s2=1} Fire damage, and enhances your weapons with fire for {$194084d=16 seconds}, causing each weapon attack to deal up to ${$<coeff>*$AP} Fire damage, based on weapon speed.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Frostbrand 9089 (126450) 0.7% (9.2%) 18.8 16.32sec 2018171 1902375 Direct 18.8 118686 237136 145491 22.6% 0.0%  

Stats details: frostbrand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.78 18.78 87.34 0.00 1.0609 3.2920 2732108.35 2732108.35 0.00 123267.98 1902374.70
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.53 77.37% 118686.19 111001 130010 118737.84 113333 124102 1724476 1724476 0.00
crit 4.25 22.63% 237135.83 222001 260020 234371.70 0 260020 1007632 1007632 0.00
 
 

Action details: frostbrand

Static Values
  • id:196834
  • school:frost
  • resource:maelstrom
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.hailstorm.enabled&!buff.frostbrand.up&variable.furyCheck45
Spelldata
  • id:196834
  • name:Frostbrand
  • school:frost
  • tooltip:Melee attacks reduce target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
  • description:Chills your target, dealing {$s1=1} Frost damage and reducing the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}, and enhances your weapons with frost for {$d=16 seconds}, causing each weapon attack to reduce the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.925000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.00
  • base_tick_time:5.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Hailstorm 117362 8.6% 908.1 0.60sec 38726 0 Direct 908.1 31491 62991 38726 23.0% 0.0%  

Stats details: hailstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 908.10 908.10 0.00 0.00 0.0000 0.0000 35167000.45 35167000.45 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 699.53 77.03% 31491.12 28255 33735 31499.46 30929 32113 22029051 22029051 0.00
crit 208.57 22.97% 62991.35 56510 67470 63007.71 61847 64506 13137950 13137950 0.00
 
 

Action details: hailstorm

Static Values
  • id:210854
  • school:frost
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210854
  • name:Hailstorm
  • school:frost
  • tooltip:
  • description:{$@spelldesc210853=Frostbrand now also enhances your weapon's damage, causing each of your weapon attacks to also deal $210854sw1 Frost damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.30
 
Lava Lash 98893 (109505) 7.3% (8.0%) 35.3 8.03sec 934321 881430 Direct 35.3 682563 1359415 843532 23.8% 0.0%  

Stats details: lava_lash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.32 35.32 0.00 0.00 1.0600 0.0000 29792870.17 29792870.17 0.00 881429.82 881429.82
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.92 76.22% 682563.38 454911 1478679 690864.18 544236 1021824 18376364 18376364 0.00
crit 8.40 23.78% 1359414.70 909823 2957357 1369801.46 0 2899810 11416506 11416506 0.00
 
 

Action details: lava_lash

Static Values
  • id:60103
  • school:fire
  • resource:maelstrom
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.hot_hand.react&((variable.akainuEquipped&buff.frostbrand.up)|!variable.akainuEquipped)
Spelldata
  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing $sw1 Fire damage.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:7.81
 
    Doom Vortex (_ll) 10612 0.8% 42.0 6.09sec 76342 0 Direct 42.0 61834 123668 76348 23.5% 0.0%  

Stats details: doom_vortex_ll

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.97 41.97 0.00 0.00 0.0000 0.0000 3204336.50 3204336.50 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.12 76.53% 61834.17 53634 67845 61861.82 58282 65710 1986352 1986352 0.00
crit 9.85 23.47% 123667.95 107269 135691 123711.65 0 135691 1217985 1217985 0.00
 
 

Action details: doom_vortex_ll

Static Values
  • id:199116
  • school:fire
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:199116
  • name:Doom Vortex
  • school:fire
  • tooltip:
  • description:{$@spelldesc199107=Lava Lash{$?s210727=false}[ and Lightning Bolt have][ has] a chance to cause |cFFFFCC99Doomhammer|r to release a fiery tornado at your target's location, dealing ${3*{$199116s1=1}} Fire damage over {$199121d=3 seconds} to enemies within $199116A1 yards.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.600000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
main_hand 19643 1.4% 133.5 2.25sec 44428 28370 Direct 133.5 42775 85553 44431 22.9% 19.0%  

Stats details: main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 133.52 133.52 0.00 0.00 1.5660 0.0000 5931994.49 8720593.80 31.98 28369.99 28369.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.60 58.12% 42774.68 38433 46041 42789.59 41942 43936 3319286 4879664 31.98
crit 30.54 22.87% 85552.88 76867 92082 85583.72 83311 88918 2612709 3840930 31.98
miss 25.38 19.01% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Mark of the Hidden Satyr 21589 1.6% 20.6 14.59sec 315363 0 Direct 20.6 257206 514369 315372 22.6% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.56 20.56 0.00 0.00 0.0000 0.0000 6482567.20 6482567.20 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.91 77.38% 257206.34 220165 282681 257260.28 243834 271315 4091402 4091402 0.00
crit 4.65 22.62% 514369.08 446936 565361 508903.87 0 565361 2391165 2391165 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
offhand 9794 0.7% 133.0 2.25sec 22241 14147 Direct 133.0 21400 42821 22241 22.9% 19.0%  

Stats details: offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 132.99 132.99 0.00 0.00 1.5721 0.0000 2957911.85 4348410.60 31.98 14147.00 14147.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.28 58.11% 21400.18 19217 23021 21407.95 20895 21986 1653908 2431401 31.98
crit 30.45 22.90% 42820.67 38433 46041 42836.93 41621 44301 1304004 1917009 31.98
miss 25.26 18.99% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: offhand

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Rockbiter 99528 7.3% 55.3 5.39sec 543135 507539 Direct 55.3 440248 880833 543163 23.4% 0.0%  

Stats details: rockbiter

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.27 55.27 0.00 0.00 1.0702 0.0000 30016864.67 30016864.67 0.00 507538.88 507538.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.36 76.65% 440247.94 406397 483136 440448.71 430030 457666 18648632 18648632 0.00
crit 12.91 23.35% 880833.49 824986 966273 881242.89 843558 943607 11368232 11368232 0.00
 
 

Action details: rockbiter

Static Values
  • id:193786
  • school:nature
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.landslide.enabled&!buff.landslide.up
Spelldata
  • id:193786
  • name:Rockbiter
  • school:nature
  • tooltip:
  • description:Assaults your target with earthen power, dealing {$s1=0} Nature damage. |cFFFFFFFFGenerates {$s2=25} Maelstrom.|r
 
Stormlash 39544 2.9% 703.6 1.08sec 16861 0 Direct 703.6 16861 0 16861 0.0% 0.0%  

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 703.65 703.65 0.00 0.00 0.0000 0.0000 11863904.90 11863904.90 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 703.65 100.00% 16860.91 2717 101853 16866.04 14831 19319 11863905 11863905 0.00
 
 

Action details: stormlash

Static Values
  • id:213307
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:213307
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:{$@spelldesc195255=While your weapons are enhanced, your attacks have a chance to grant Stormlash to up to {$?s210731=false}[${$m1+$210731m1}][{$s1=2}] party or raid members for {$195222d=8 seconds}, causing attacks and spellcasts to deal additional Nature damage.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:2.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9711.73
  • base_dd_max:9711.73
 
Stormstrike 0 (278458) 0.0% (20.4%) 77.3 3.59sec 1086672 1007397

Stats details: stormstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.26 0.00 0.00 0.00 1.0787 0.0000 0.00 0.00 0.00 1007396.55 1007396.55
 
 

Action details: stormstrike

Static Values
  • id:17364
  • school:physical
  • resource:maelstrom
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.stormbringer.up&variable.furyCheck25
Spelldata
  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of ${$32175sw1+$32176sw1} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
    Stormstrike (_mh) 185730 13.6% 96.5 3.59sec 580165 0 Direct 96.5 365963 888418 580129 41.0% 0.0%  

Stats details: stormstrike_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.51 96.51 0.00 0.00 0.0000 0.0000 55993240.00 82315366.63 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.94 59.00% 365962.81 150336 572971 366573.92 294913 422604 20838138 30634036 31.98
crit 39.57 41.00% 888417.88 300671 1145942 889597.66 735778 997411 35155102 51681330 31.98
 
 

Action details: stormstrike_mh

Static Values
  • id:32175
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of ${$32175sw1+$32176sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:7.50
 
    Stormstrike Off-Hand 92728 6.8% 96.5 3.59sec 289715 0 Direct 96.5 183027 444417 289712 40.8% 0.0%  

Stats details: stormstrike_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.51 96.51 0.00 0.00 0.0000 0.0000 27961173.87 41105574.14 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.12 59.18% 183027.08 75168 286486 183359.27 150569 214162 10454515 15369127 31.98
crit 39.39 40.82% 444417.36 150336 572971 444944.94 385012 503273 17506659 25736447 31.98
 
 

Action details: stormstrike_offhand

Static Values
  • id:32176
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of ${$32175sw1+$32176sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:7.50
 
Unleash Lava 49024 3.6% 132.5 3.06sec 110302 0 Direct 131.0 90836 181692 111570 22.8% 0.0%  

Stats details: unleash_lava

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 132.51 131.01 0.00 0.00 0.0000 0.0000 14616146.76 14616146.76 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 101.11 77.18% 90835.98 77500 99506 90866.32 87513 95208 9184612 9184612 0.00
crit 29.89 22.82% 181692.03 155001 199012 181740.09 174271 192707 5431534 5431534 0.00
 
 

Action details: unleash_lava

Static Values
  • id:199053
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:1.2000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:199053
  • name:Unleash Lava
  • school:fire
  • tooltip:
  • description:{$@spelldesc198736=Stormstrike has a chance to unleash the power of |cFFFFCC99Doomhammer|r, causing your special attacks to heave molten lava or lightning spikes at your target for {$199053s1=1} Fire or Nature damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.800000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Unleash Lightning 49092 3.6% 132.7 3.05sec 110316 0 Direct 131.1 90819 181741 111607 22.9% 0.0%  

Stats details: unleash_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 132.68 131.15 0.00 0.00 0.0000 0.0000 14637050.83 14637050.83 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 101.17 77.14% 90819.11 77500 99506 90848.45 87496 94736 9187770 9187770 0.00
crit 29.98 22.86% 181741.24 157326 199012 181788.06 172817 192855 5449280 5449280 0.00
 
 

Action details: unleash_lightning

Static Values
  • id:199054
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:1.2000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:199054
  • name:Unleash Lightning
  • school:nature
  • tooltip:
  • description:{$@spelldesc198736=Stormstrike has a chance to unleash the power of |cFFFFCC99Doomhammer|r, causing your special attacks to heave molten lava or lightning spikes at your target for {$199053s1=1} Fire or Nature damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.800000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Windlash (wind_lash) 14449 1.0% 55.0 4.96sec 77693 59739 Direct 55.0 63194 126405 77698 22.9% 0.0%  

Stats details: wind_lash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.05 55.05 0.00 0.00 1.3006 0.0000 4276875.02 4276875.02 0.00 59738.73 59738.73
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.42 77.06% 63193.66 55666 67685 63232.64 61041 66593 2680717 2680717 0.00
crit 12.63 22.94% 126404.54 113001 135370 126527.30 119733 135370 1596158 1596158 0.00
 
 

Action details: wind_lash

Static Values
  • id:114089
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114089
  • name:Windlash
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals $sw1 Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Windlash Off-Hand (wind_lash_offhand) 7222 0.5% 55.1 4.96sec 38815 29887 Direct 55.1 31595 63209 38813 22.8% 0.0%  

Stats details: wind_lash_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.06 55.06 0.00 0.00 1.2988 0.0000 2137051.33 2137051.33 0.00 29886.74 29886.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.48 77.16% 31595.35 27833 33842 31616.90 30612 33438 1342241 1342241 0.00
crit 12.57 22.84% 63209.34 56501 67685 63242.24 60147 67685 794810 794810 0.00
 
 

Action details: wind_lash_offhand

Static Values
  • id:114093
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114093
  • name:Windlash Off-Hand
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals $sw1 Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Windfury Attack 74447 5.4% 186.5 3.26sec 119376 0 Direct 186.5 96946 194613 119373 23.0% 0.0%  

Stats details: windfury_attack

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 186.49 186.49 0.00 0.00 0.0000 0.0000 22263118.66 32728893.25 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 143.67 77.04% 96945.53 55030 200065 97179.68 83025 115821 13928623 20476395 31.98
crit 42.83 22.96% 194613.44 111710 400130 195117.82 134505 278958 8334496 12252498 31.98
 
 

Action details: windfury_attack

Static Values
  • id:25504
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Each of your main hand attacks has a {$33757h=20}% chance to trigger two extra attacks, dealing $25504sw2 Physical damage each.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Windfury Attack (_oh) 14767 1.1% 38.3 14.85sec 115266 0 Direct 38.3 93505 187155 115268 23.2% 0.0%  

Stats details: windfury_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.31 38.31 0.00 0.00 0.0000 0.0000 4415282.57 6490883.61 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.40 76.76% 93505.17 83783 100032 93538.50 89076 98067 2749425 4041916 31.98
crit 8.90 23.24% 187155.02 167566 200065 187202.30 177688 200065 1665857 2448968 31.98
 
 

Action details: windfury_attack_oh

Static Values
  • id:33750
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:33750
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:$@spelldesc8232
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Windstrike 0 (282558) 0.0% (20.3%) 55.5 4.90sec 1502908 1531109

Stats details: windstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.52 0.00 0.00 0.00 0.9816 0.0000 0.00 0.00 0.00 1531109.27 1531109.27
 
 

Action details: windstrike

Static Values
  • id:115356
  • school:physical
  • resource:maelstrom
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(variable.heartEquipped|set_bonus.tier19_2pc)&(!talent.earthen_spike.enabled|(cooldown.earthen_spike.remains>1&cooldown.doom_winds.remains>1)|debuff.earthen_spike.up)
Spelldata
  • id:115356
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:Hurl a staggering blast of wind at an enemy, dealing a total of ${$115357sw1+$115360sw1} Physical damage, bypassing armor.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
    Windstrike (_mh) 188437 13.5% 69.5 4.90sec 801156 0 Direct 69.5 531462 1266332 801237 36.7% 0.0%  

Stats details: windstrike_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.46 69.45 0.00 0.00 0.0000 0.0000 55647100.44 55647100.44 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.95 63.29% 531461.89 205945 842322 533131.28 435334 637547 23359697 23359697 0.00
crit 25.50 36.71% 1266331.80 418069 1684644 1269228.79 994832 1468797 32287404 32287404 0.00
 
 

Action details: windstrike_mh

Static Values
  • id:115357
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115357
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of ${$115357sw1+$115360sw1} Physical damage, bypassing armor.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:7.50
 
    Windstrike Off-Hand 94121 6.8% 69.5 4.90sec 400171 0 Direct 69.5 266062 632209 400230 36.6% 0.0%  

Stats details: windstrike_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.46 69.45 0.00 0.00 0.0000 0.0000 27795292.72 27795292.72 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.00 63.36% 266061.70 102973 421161 266949.87 219260 311571 11708106 11708106 0.00
crit 25.45 36.64% 632209.19 209035 842322 633612.19 484174 726762 16087187 16087187 0.00
 
 

Action details: windstrike_offhand

Static Values
  • id:115360
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115360
  • name:Windstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of ${$115357sw1+$115360sw1} Physical damage, bypassing armor.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:7.50
 
pet - frost_wolf 323677 / 19707
Frozen Bite 148299 0.7% 8.2 30.02sec 332434 0 Direct 8.2 268815 537600 332494 23.7% 0.0%  

Stats details: frozen_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.16 8.16 0.00 0.00 0.0000 0.0000 2711736.30 2711736.30 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.23 76.33% 268815.23 236633 294910 266929.24 0 294910 1673772 1673772 0.00
crit 1.93 23.67% 537600.34 473265 589819 445020.66 0 589819 1037964 1037964 0.00
 
 

Action details: frozen_bite

Static Values
  • id:224126
  • school:frost
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224126
  • name:Frozen Bite
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Bite the target, causing {$s1=1} Frost damage and slowing the target's movement speed by {$s2=50}% for {$d=4 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
melee 105643 0.5% 47.4 4.56sec 40392 48143 Direct 47.4 32755 65484 40393 23.3% 0.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.36 47.36 0.00 0.00 0.8390 0.0000 1912901.82 2812146.87 31.98 48142.69 48142.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.31 76.67% 32755.22 28640 35693 32676.22 0 35693 1189268 1748337 31.96
crit 11.05 23.33% 65483.59 57279 71386 65206.39 0 71386 723634 1063810 31.89
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Snowstorm 69734 0.3% 14.3 15.15sec 88851 0 Direct 14.3 72092 144138 88848 23.3% 0.0%  

Stats details: snowstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.26 14.26 0.00 0.00 0.0000 0.0000 1267114.46 1267114.46 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.94 76.74% 72091.56 63102 78642 71525.91 0 78642 788965 788965 0.00
crit 3.32 23.26% 144138.50 126203 157284 132127.18 0 157284 478150 478150 0.00
 
 

Action details: snowstorm

Static Values
  • id:198483
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198483
  • name:Snowstorm
  • school:frost
  • tooltip:
  • description:Deals {$s1=0} Frost damage to all targets within $A1 yards.
 
pet - fiery_wolf 398259 / 24734
Fiery Jaws 224137 1.0% 8.3 29.62sec 504250 0 Direct 8.3 179047 358736 220433 23.0% 0.0%  
Periodic 32.9 71754 0 71754 0.0% 0.0% 10.9%

Stats details: fiery_jaws

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.31 8.31 32.85 32.85 0.0000 1.0000 4188675.76 4188675.76 0.00 127493.63 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.39 76.96% 179047.48 157756 196607 178508.55 0 196607 1144639 1144639 0.00
crit 1.91 23.04% 358736.15 315511 393214 294588.45 0 393214 686569 686569 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.9 100.00% 71754.15 63103 78644 71665.93 0 78158 2357468 2357468 0.00
 
 

Action details: fiery_jaws

Static Values
  • id:224125
  • school:fire
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224125
  • name:Fiery Jaws
  • school:fire
  • tooltip:Suffering {$s2=1} Fire damage every $t sec.
  • description:Bite the target for {$s1=1} Fire damage, causing an additional $o2 Fire damage over {$d=4 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.400000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Fire Nova 69589 0.3% 14.5 15.05sec 89164 0 Direct 14.5 72028 143908 89165 23.8% 0.0%  

Stats details: fire_nova

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.50 14.50 0.00 0.00 0.0000 0.0000 1292831.45 1292831.45 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.04 76.16% 72027.51 63102 78642 71735.93 0 78642 795366 795366 0.00
crit 3.46 23.84% 143907.83 126203 157284 133063.88 0 157284 497466 497466 0.00
 
 

Action details: fire_nova

Static Values
  • id:198480
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198480
  • name:Fire Nova
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to all targets within $A1 yards.
 
melee 104534 0.5% 48.3 4.55sec 40352 48166 Direct 48.3 32734 65473 40351 23.3% 0.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.28 48.28 0.00 0.00 0.8378 0.0000 1948320.86 2864216.21 31.98 48166.15 48166.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.05 76.73% 32734.11 28640 35693 32710.18 30514 35554 1212758 1782869 31.98
crit 11.23 23.27% 65472.66 57279 71386 65231.57 0 71386 735563 1081347 31.88
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lightning_wolf 267440 / 15390
melee 158237 0.7% 48.8 4.48sec 56327 67250 Direct 48.8 45585 91279 56327 23.5% 0.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.81 48.81 0.00 0.00 0.8376 0.0000 2749375.41 4041842.28 31.98 67249.84 67249.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.34 76.49% 45584.87 28640 53539 45502.24 0 51686 1701923 2501987 31.96
crit 11.47 23.51% 91279.13 57279 107079 90756.94 0 107079 1047453 1539855 31.83
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Thunder Bite 109204 0.5% 14.5 14.95sec 128491 0 Direct 14.5 104368 208479 128480 23.2% 0.0%  

Stats details: thunder_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.53 14.53 0.00 0.00 0.0000 0.0000 1866944.17 1866944.17 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.16 76.82% 104368.05 63102 117963 103684.64 0 117963 1164910 1164910 0.00
crit 3.37 23.18% 208479.06 126203 235926 191856.40 0 235926 702034 702034 0.00
 
 

Action details: thunder_bite

Static Values
  • id:198485
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198485
  • name:Thunder Bite
  • school:nature
  • tooltip:
  • description:Deals {$s1=0} Nature damage, jumping to up to $x targets.
 
Simple Action Stats Execute Interval
T19 4pc - T20 2pc
Ascendance 2.0 185.30sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.04 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114051
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.doom_winds.up
Spelldata
  • id:114051
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a $114089r yard range. Stormstrike is empowered and has a $114089r yard range.
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, reducing the cooldown and cost of Stormstrike by {$s4=80}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$s1=30} yd range.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T19 4pc - T20 2pc
  • harmful:false
  • if_expr:
 
Berserking 2.0 189.92sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.03 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ascendance.up|(feral_spirit.remains>5)|level<100
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Doom Winds 5.3 61.69sec

Stats details: doom_winds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.33 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: doom_winds

Static Values
  • id:204945
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:debuff.earthen_spike.up&talent.earthen_spike.enabled|!talent.earthen_spike.enabled
Spelldata
  • id:204945
  • name:Doom Winds
  • school:physical
  • tooltip:Chance to proc Windfury weapon on auto attacks increased by 100%. Windfury damage increased by {$s2=200}%.
  • description:Unleashes the inner power of the |cFFFFCC99Doomhammer|r, causing all auto attacks to trigger Windfury, and increasing damage dealt by Windfury by {$s2=200}% for {$d=6 seconds}.
 
Feral Spirit 3.0 121.08sec

Stats details: feral_spirit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.97 0.00 0.00 0.00 1.0192 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: feral_spirit

Static Values
  • id:51533
  • school:nature
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects$?a231723[ and grant you {$190185s1=5} Maelstrom each time they attack][].
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T19 4pc - T20 2pc
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T19 4pc - T20 2pc
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
pet - lightning_wolf
Crackling Surge 8.4 29.73sec

Stats details: crackling_surge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.42 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: crackling_surge

Static Values
  • id:224127
  • school:nature
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224127
  • name:Crackling Surge
  • school:nature
  • tooltip:Damage dealt increased by {$s1=50}%.
  • description:The Doom Wolf surges with electric energy, increasing all damage dealt by {$s1=50}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 6.4 0.1 47.7sec 46.6sec 27.54% 87.82% 0.1(0.1) 6.1

Buff details

  • buff initial source:T19 4pc - T20 2pc
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:27.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114051
  • name:Ascendance
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a $114089r yard range. Stormstrike is empowered and has a $114089r yard range.
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, reducing the cooldown and cost of Stormstrike by {$s4=80}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$s1=30} yd range.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Berserking 2.0 0.0 190.0sec 190.0sec 6.80% 11.45% 0.0(0.0) 2.0

Buff details

  • buff initial source:T19 4pc - T20 2pc
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.57% 13.57% 0.0(0.0) 1.0

Buff details

  • buff initial source:T19 4pc - T20 2pc
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.57%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Chill of the Twisting Nether 1.1 941.6 165.6sec 0.3sec 99.25% 99.34% 941.6(941.6) 0.1

Buff details

  • buff initial source:T19 4pc - T20 2pc
  • cooldown name:buff_chill_of_the_twisting_nether
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02

Stack Uptimes

  • chill_of_the_twisting_nether_1:99.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:207998
  • name:Chill of the Twisting Nether
  • tooltip:All damage done increased by ${{$s1=15}/10}.1%.
  • description:{$@spelldesc207994=Damaging enemies with your Fire, Frost, or Nature abilities increases all damage you deal by ${{$207995s1=15}/10}.1% for {$207995d=8 seconds}. Each element adds a separate application.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.7sec 25.1sec 32.02% 32.02% 3.1(3.1) 7.9

Buff details

  • buff initial source:T19 4pc - T20 2pc
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Doom Winds 5.3 0.0 61.7sec 61.7sec 10.50% 18.84% 0.0(0.0) 5.2

Buff details

  • buff initial source:T19 4pc - T20 2pc
  • cooldown name:buff_doom_winds
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • doom_winds_1:10.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:204945
  • name:Doom Winds
  • tooltip:Chance to proc Windfury weapon on auto attacks increased by 100%. Windfury damage increased by {$s2=200}%.
  • description:Unleashes the inner power of the |cFFFFCC99Doomhammer|r, causing all auto attacks to trigger Windfury, and increasing damage dealt by Windfury by {$s2=200}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:60.00
  • default_chance:0.00%
Fire of the Twisting Nether 1.0 1143.9 100.1sec 0.3sec 99.62% 99.70% 1143.9(1143.9) 0.0

Buff details

  • buff initial source:T19 4pc - T20 2pc
  • cooldown name:buff_fire_of_the_twisting_nether
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02

Stack Uptimes

  • fire_of_the_twisting_nether_1:99.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:207995
  • name:Fire of the Twisting Nether
  • tooltip:All damage done increased by ${{$s1=15}/10}.1%.
  • description:{$@spelldesc207994=Damaging enemies with your Fire, Frost, or Nature abilities increases all damage you deal by ${{$207995s1=15}/10}.1% for {$207995d=8 seconds}. Each element adds a separate application.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Flametongue 6.4 13.1 48.1sec 15.7sec 97.70% 97.83% 31.7(31.7) 5.4

Buff details

  • buff initial source:T19 4pc - T20 2pc
  • cooldown name:buff_flametongue
  • max_stacks:1
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • flametongue_1:97.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194084
  • name:Flametongue
  • tooltip:Each of your weapon attacks causes up to ${$<coeff>*$AP} additional Fire damage.
  • description:{$@spelldesc193796=Scorches your target, dealing {$s2=1} Fire damage, and enhances your weapons with fire for {$194084d=16 seconds}, causing each weapon attack to deal up to ${$<coeff>*$AP} Fire damage, based on weapon speed.}
  • max_stacks:0
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
Frostbrand 8.5 10.3 36.0sec 16.3sec 96.13% 96.49% 47.5(47.5) 7.5

Buff details

  • buff initial source:T19 4pc - T20 2pc
  • cooldown name:buff_frostbrand
  • max_stacks:1
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • frostbrand_1:96.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196834
  • name:Frostbrand
  • tooltip:Melee attacks reduce target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
  • description:Chills your target, dealing {$s1=1} Frost damage and reducing the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}, and enhances your weapons with frost for {$d=16 seconds}, causing each weapon attack to reduce the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
  • max_stacks:0
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
Gathering Storms 19.1 1.6 15.9sec 14.6sec 21.62% 14.33% 1.6(1.6) 0.0

Buff details

  • buff initial source:T19 4pc - T20 2pc
  • cooldown name:buff_gathering_storms
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • gathering_storms_1:21.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:198300
  • name:Gathering Storms
  • tooltip:Damage of Stormstrike increased by $w1%.
  • description:{$@spelldesc198299=Each target hit by Crash Lightning increases damage dealt by your next Stormstrike within {$198300d=12 seconds} by {$s1=2}%.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Landslide 9.0 46.2 33.0sec 5.4sec 95.42% 88.35% 46.2(46.2) 8.1

Buff details

  • buff initial source:T19 4pc - T20 2pc
  • cooldown name:buff_landslide
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • landslide_1:95.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202004
  • name:Landslide
  • tooltip:Agility increased by {$s1=8}%.
  • description:{$@spelldesc197992=$?s201897[Boulderfist][Rockbiter] enhances your weapon, increasing your Agility by {$202004s1=8}% for {$202004d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Lightning Crash 13.1 7.6 23.3sec 14.6sec 86.79% 50.99% 7.6(7.6) 12.3

Buff details

  • buff initial source:T19 4pc - T20 2pc
  • cooldown name:buff_lightning_crash
  • max_stacks:1
  • duration:16.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.05

Stack Uptimes

  • lightning_crash_1:86.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242284
  • name:Lightning Crash
  • tooltip:Critical strike chance increased by {$s1=5}%.
  • description:{$@spelldesc242283=Crash Lightning increases your critical strike chance by {$242284s1=5}% for {$242284d=16 seconds}.}
  • max_stacks:0
  • duration:16.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 107.8sec 0.0sec 40.01% 40.01% 0.0(0.0) 2.0

Buff details

  • buff initial source:T19 4pc - T20 2pc
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:40.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Shock of the Twisting Nether 2.1 216.7 123.5sec 1.4sec 99.34% 99.25% 216.7(216.7) 1.1

Buff details

  • buff initial source:T19 4pc - T20 2pc
  • cooldown name:buff_shock_of_the_twisting_nether
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02

Stack Uptimes

  • shock_of_the_twisting_nether_1:99.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:207999
  • name:Shock of the Twisting Nether
  • tooltip:All damage done increased by ${{$s1=15}/10}.1%.
  • description:{$@spelldesc207994=Damaging enemies with your Fire, Frost, or Nature abilities increases all damage you deal by ${{$207995s1=15}/10}.1% for {$207995d=8 seconds}. Each element adds a separate application.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 67.8 7.5 4.4sec 3.9sec 21.92% 50.91% 11.7(12.3) 0.0

Buff details

  • buff initial source:T19 4pc - T20 2pc
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormbringer_1:21.92%

Trigger Attempt Success

  • trigger_pct:93.92%

Spelldata details

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike has no cooldown and its cost is reduced by {$s3=50}%.
  • description:{$@spelldesc201845=Your weapon attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike, and cause your next Stormstrike to cost {$201846s3=50}% less Maelstrom and trigger no cooldown.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Stormlash 14.2 10.6 21.6sec 12.1sec 50.41% 50.41% 10.6(10.6) 13.7

Buff details

  • buff initial source:T19 4pc - T20 2pc
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormlash_1:50.41%

Trigger Attempt Success

  • trigger_pct:99.87%

Spelldata details

  • id:195222
  • name:Stormlash
  • tooltip:Empowered with lightning. Attacks and spellcasts have a chance to deal additional Nature damage.
  • description:{$@spelldesc195255=While your weapons are enhanced, your attacks have a chance to grant Stormlash to up to {$?s210731=false}[${$m1+$210731m1}][{$s1=2}] party or raid members for {$195222d=8 seconds}, causing attacks and spellcasts to deal additional Nature damage.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Unleash Doom 16.1 17.2 18.6sec 8.8sec 46.29% 52.23% 17.2(17.2) 15.6

Buff details

  • buff initial source:T19 4pc - T20 2pc
  • cooldown name:buff_unleash_doom
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-0.00

Stack Uptimes

  • unleash_doom_1:46.29%

Trigger Attempt Success

  • trigger_pct:20.12%

Spelldata details

  • id:199055
  • name:Unleash Doom
  • tooltip:Your special attacks will trigger an arc of fiery or lightning damage at your target.
  • description:{$@spelldesc198736=Stormstrike has a chance to unleash the power of |cFFFFCC99Doomhammer|r, causing your special attacks to heave molten lava or lightning spikes at your target for {$199053s1=1} Fire or Nature damage.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Wind Strikes 16.6 58.7 18.4sec 3.9sec 74.73% 79.54% 59.5(63.5) 15.8

Buff details

  • buff initial source:T19 4pc - T20 2pc
  • cooldown name:buff_wind_strikes
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.85

Stack Uptimes

  • wind_strikes_1:74.73%

Trigger Attempt Success

  • trigger_pct:93.92%

Spelldata details

  • id:198293
  • name:Wind Strikes
  • tooltip:Attack speed increased by $w1%.
  • description:{$@spelldesc198292=When Stormbringer resets the remaining cooldown on Stormstrike, you gain {$s1=3}% attack speed for {$198293d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
fiery_wolf: Alpha Wolf 1.6 0.5 97.0sec 55.5sec 73.00% 73.00% 7.6(7.6) 0.8

Buff details

  • buff initial source:T19 4pc - T20 2pc_fiery_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:73.00%

Trigger Attempt Success

  • trigger_pct:99.01%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
fiery_wolf: Alpha Wolf 1.6 0.8 103.3sec 46.4sec 75.63% 75.63% 8.1(8.1) 0.6

Buff details

  • buff initial source:T19 4pc - T20 2pc_fiery_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:75.63%

Trigger Attempt Success

  • trigger_pct:98.74%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
frost_wolf: Alpha Wolf 1.6 0.6 96.7sec 54.7sec 72.70% 72.70% 7.7(7.7) 0.8

Buff details

  • buff initial source:T19 4pc - T20 2pc_frost_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:72.70%

Trigger Attempt Success

  • trigger_pct:98.24%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
frost_wolf: Alpha Wolf 1.6 0.8 110.1sec 47.2sec 75.91% 75.91% 8.2(8.2) 0.6

Buff details

  • buff initial source:T19 4pc - T20 2pc_frost_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:75.91%

Trigger Attempt Success

  • trigger_pct:98.49%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Alpha Wolf 1.7 0.5 93.8sec 55.6sec 72.55% 72.55% 7.6(7.6) 0.8

Buff details

  • buff initial source:T19 4pc - T20 2pc_lightning_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:72.55%

Trigger Attempt Success

  • trigger_pct:98.21%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Alpha Wolf 1.6 0.8 103.9sec 45.8sec 75.94% 75.94% 8.2(8.2) 0.6

Buff details

  • buff initial source:T19 4pc - T20 2pc_lightning_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:75.94%

Trigger Attempt Success

  • trigger_pct:99.02%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Crackling Surge 4.2 0.0 23.2sec 23.2sec 76.08% 71.31% 0.0(0.0) 2.8

Buff details

  • buff initial source:T19 4pc - T20 2pc_lightning_wolf
  • cooldown name:buff_crackling_surge
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • crackling_surge_1:76.08%

Trigger Attempt Success

  • trigger_pct:99.71%

Spelldata details

  • id:224127
  • name:Crackling Surge
  • tooltip:Damage dealt increased by {$s1=50}%.
  • description:The Doom Wolf surges with electric energy, increasing all damage dealt by {$s1=50}%.
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Crackling Surge 4.2 0.0 23.2sec 23.2sec 76.16% 71.21% 0.0(0.0) 2.8

Buff details

  • buff initial source:T19 4pc - T20 2pc_lightning_wolf
  • cooldown name:buff_crackling_surge
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • crackling_surge_1:76.16%

Trigger Attempt Success

  • trigger_pct:99.83%

Spelldata details

  • id:224127
  • name:Crackling Surge
  • tooltip:Damage dealt increased by {$s1=50}%.
  • description:The Doom Wolf surges with electric energy, increasing all damage dealt by {$s1=50}%.
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:T19 4pc - T20 2pc
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:T19 4pc - T20 2pc
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:T19 4pc - T20 2pc
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201639
  • name:Well Fed
  • tooltip:Agility increased by $w1.
  • description:Agility increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Strength of Will

Buff details

  • buff initial source:T19 4pc - T20 2pc
  • cooldown name:buff_strength_of_will
  • max_stacks:10
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:304.77

Stack Uptimes

  • strength_of_will_10:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242642
  • name:Strength of Will
  • tooltip:Strength or Agility increased by {$s3=95}, based on your specialization.
  • description:{$@spelldesc242640=While you are above {$s1=80}% health you gain {$242642s3=95} Strength or Agility per second, based on your specialization, stacking up to {$242642u=10} times. If you fall below {$s2=50}% health, this effect is lost.}
  • max_stacks:10
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
Stormbringer: T19 4PC 3.6 59.3sec
Flametongue: Windfury Attack 221.4 2.7sec
Frostbrand: Windfury Attack 219.2 2.7sec
Maelstrom Weapon: Windfury Attack 224.8 2.7sec
Stormbringer: Windfury Attack 13.8 21.5sec
Stormbringer: Windfury Attack Off-Hand 2.9 74.0sec
Flametongue: main_hand 106.2 2.8sec
Frostbrand: main_hand 104.4 2.8sec
Maelstrom Weapon: main_hand 108.1 2.8sec
Stormbringer: main_hand 8.1 31.2sec
Windfury: main_hand 30.7 9.3sec
Flametongue: Windlash 52.9 5.1sec
Frostbrand: Windlash 51.6 5.3sec
Maelstrom Weapon: Windlash 55.0 4.9sec
Stormbringer: Windlash 4.1 52.9sec
Windfury: Windlash 20.9 12.9sec
Flametongue: offhand 105.7 2.8sec
Frostbrand: offhand 104.8 2.8sec
Maelstrom Weapon: offhand 107.7 2.8sec
Stormbringer: offhand 7.9 31.7sec
Windfury: offhand 8.2 25.3sec
Flametongue: Windlash Off-Hand 52.9 5.1sec
Frostbrand: Windlash Off-Hand 51.5 5.3sec
Maelstrom Weapon: Windlash Off-Hand 55.1 4.9sec
Stormbringer: Windlash Off-Hand 4.1 52.5sec
Windfury: Windlash Off-Hand 10.9 21.5sec
Flametongue: Windstrike 66.1 5.1sec
Frostbrand: Windstrike 64.3 5.3sec
Stormbringer: Windstrike 5.1 45.5sec
Windfury: Windstrike 15.5 18.2sec
Unleash Doom (damage): Windstrike 47.9 6.9sec
Flametongue: Windstrike Off-Hand 66.1 5.1sec
Frostbrand: Windstrike Off-Hand 64.3 5.3sec
Stormbringer: Windstrike Off-Hand 5.1 44.7sec
Unleash Doom (damage): Windstrike Off-Hand 47.9 6.9sec
Stormbringer: Rockbiter 4.1 53.5sec
Unleash Doom (damage): Rockbiter 24.3 11.7sec
Flametongue: Crash Lightning 20.7 14.6sec
Frostbrand: Crash Lightning 20.7 14.6sec
Stormbringer: Crash Lightning 1.5 84.7sec
Windfury: Crash Lightning 4.6 52.3sec
Unleash Doom (damage): Crash Lightning 8.7 32.6sec
Stormbringer: Flametongue 1.4 84.6sec
Unleash Doom (damage): Flametongue 8.7 32.4sec
Stormbringer: Frostbrand 1.4 89.3sec
Unleash Doom (damage): Frostbrand 8.0 34.7sec
Flametongue: Stormstrike 96.5 3.6sec
Frostbrand: Stormstrike 96.5 3.6sec
Stormbringer: Stormstrike 7.1 33.4sec
Windfury: Stormstrike 21.6 13.1sec
Unleash Doom (damage): Stormstrike 54.7 6.2sec
Flametongue: Stormstrike Off-Hand 96.5 3.6sec
Frostbrand: Stormstrike Off-Hand 96.5 3.6sec
Stormbringer: Stormstrike Off-Hand 7.3 32.7sec
Unleash Doom (damage): Stormstrike Off-Hand 54.7 6.2sec
Flametongue: Lava Lash 35.3 8.1sec
Frostbrand: Lava Lash 35.3 8.1sec
Stormbringer: Lava Lash 2.7 69.6sec
Unleash Doom (damage): Lava Lash 10.7 24.7sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Windstrike0.7970.0019.19146.5622.125105.778
Feral Spirit1.2160.00118.7942.2270.00025.324
Doom Winds1.7620.00122.5187.4240.22732.043
Ascendance5.3320.19330.4425.5470.19330.442
Rockbiter3.6310.00420.88667.18822.657124.544
Crash Lightning10.6080.00149.357205.185109.769270.256
Flametongue7.3340.00127.621135.00592.266177.655
Stormstrike1.4170.00111.055121.22747.334222.846

Resources

Resource Usage Type Count Total Average RPE APR
T19 4pc - T20 2pc
crash_lightning Maelstrom 37.0 740.1 20.0 35.7 10334.8
frostbrand Maelstrom 33.5 670.2 20.0 35.7 56549.6
lava_lash Maelstrom 63.0 1891.2 30.0 53.5 17447.8
stormstrike Maelstrom 172.2 3966.1 23.0 51.3 21168.2
windstrike Maelstrom 123.9 618.9 5.0 11.1 134822.3
Resource Gains Type Count Total Average Overflow
Windfury Attack Maelstrom 401.12 2206.53 (27.42%) 5.50 601.30 21.42%
Main Hand Maelstrom 192.98 932.25 (11.59%) 4.83 32.63 3.38%
Windlash Maelstrom 98.23 370.56 (4.61%) 3.77 120.57 24.55%
Off-Hand Maelstrom 192.25 925.29 (11.50%) 4.81 35.97 3.74%
Windlash Off-Hand Maelstrom 98.24 366.32 (4.55%) 3.73 124.90 25.43%
Feral Spirit Maelstrom 179.26 581.77 (7.23%) 3.25 314.54 35.09%
Rockbiter Maelstrom 98.62 2664.12 (33.11%) 27.01 195.95 6.85%
Resource RPS-Gain RPS-Loss
Maelstrom 14.99 14.70
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 90.91 0.00 150.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data T19 4pc - T20 2pc Fight Length
Count 2497
Mean 300.72
Minimum 203.16
Maximum 393.35
Spread ( max - min ) 190.18
Range [ ( max - min ) / 2 * 100% ] 31.62%
Standard Deviation 42.2849
5th Percentile 235.34
95th Percentile 369.68
( 95th Percentile - 5th Percentile ) 134.33
Mean Distribution
Standard Deviation 0.8462
95.00% Confidence Intervall ( 299.06 - 302.38 )
Normalized 95.00% Confidence Intervall ( 99.45% - 100.55% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 760
0.1% Error 75953
0.1 Scale Factor Error with Delta=300 16
0.05 Scale Factor Error with Delta=300 62
0.01 Scale Factor Error with Delta=300 1527
DPS
Sample Data T19 4pc - T20 2pc Damage Per Second
Count 2497
Mean 1372489.13
Minimum 1165898.06
Maximum 1651820.62
Spread ( max - min ) 485922.56
Range [ ( max - min ) / 2 * 100% ] 17.70%
Standard Deviation 72420.0731
5th Percentile 1260207.15
95th Percentile 1500561.36
( 95th Percentile - 5th Percentile ) 240354.21
Mean Distribution
Standard Deviation 1449.2713
95.00% Confidence Intervall ( 1369648.61 - 1375329.65 )
Normalized 95.00% Confidence Intervall ( 99.79% - 100.21% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 107
0.1% Error 10696
0.1 Scale Factor Error with Delta=300 44771494
0.05 Scale Factor Error with Delta=300 179085976
0.01 Scale Factor Error with Delta=300 4477149395
Priority Target DPS
Sample Data T19 4pc - T20 2pc Priority Target Damage Per Second
Count 2497
Mean 1372623.52
Minimum 1168563.13
Maximum 1651820.62
Spread ( max - min ) 483257.48
Range [ ( max - min ) / 2 * 100% ] 17.60%
Standard Deviation 71512.7222
5th Percentile 1261357.90
95th Percentile 1495592.67
( 95th Percentile - 5th Percentile ) 234234.77
Mean Distribution
Standard Deviation 1431.1134
95.00% Confidence Intervall ( 1369818.58 - 1375428.45 )
Normalized 95.00% Confidence Intervall ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 105
0.1% Error 10428
0.1 Scale Factor Error with Delta=300 43656639
0.05 Scale Factor Error with Delta=300 174626553
0.01 Scale Factor Error with Delta=300 4365663814
DPS(e)
Sample Data T19 4pc - T20 2pc Damage Per Second (Effective)
Count 2497
Mean 1372489.13
Minimum 1165898.06
Maximum 1651820.62
Spread ( max - min ) 485922.56
Range [ ( max - min ) / 2 * 100% ] 17.70%
Damage
Sample Data T19 4pc - T20 2pc Damage
Count 2497
Mean 398400944.53
Minimum 316377145.45
Maximum 480600405.66
Spread ( max - min ) 164223260.22
Range [ ( max - min ) / 2 * 100% ] 20.61%
DTPS
Sample Data T19 4pc - T20 2pc Damage Taken Per Second
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data T19 4pc - T20 2pc Healing Per Second
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data T19 4pc - T20 2pc Healing Per Second (Effective)
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data T19 4pc - T20 2pc Heal
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data T19 4pc - T20 2pc Healing Taken Per Second
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data T19 4pc - T20 2pc Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data T19 4pc - T20 2pcTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data T19 4pc - T20 2pc Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 potion
5 0.00 lightning_shield
Default action list Executed every time the actor is available.
# count action,conditions
0.00 wind_shear
0.00 variable,name=hailstormCheck,value=((talent.hailstorm.enabled&!buff.frostbrand.up)|!talent.hailstorm.enabled)
0.00 variable,name=furyCheck80,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>80))
0.00 variable,name=furyCheck70,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>70))
0.00 variable,name=furyCheck45,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>45))
0.00 variable,name=furyCheck25,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>25))
0.00 variable,name=OCPool70,value=(!talent.overcharge.enabled|(talent.overcharge.enabled&maelstrom>70))
0.00 variable,name=OCPool60,value=(!talent.overcharge.enabled|(talent.overcharge.enabled&maelstrom>60))
0.00 variable,name=heartEquipped,value=(equipped.151819)
0.00 variable,name=akainuEquipped,value=(equipped.137084)
0.00 variable,name=akainuAS,value=(variable.akainuEquipped&buff.hot_hand.react&!buff.frostbrand.up)
0.00 variable,name=LightningCrashNotUp,value=(!buff.lightning_crash.up&set_bonus.tier20_2pc)
0.00 variable,name=alphaWolfCheck,value=((pet.frost_wolf.buff.alpha_wolf.remains<2&pet.fiery_wolf.buff.alpha_wolf.remains<2&pet.lightning_wolf.buff.alpha_wolf.remains<2)&feral_spirit.remains>4)
6 1.00 auto_attack
7 7.17 use_items
8 0.00 call_action_list,name=opener
9 55.51 windstrike,if=(variable.heartEquipped|set_bonus.tier19_2pc)&(!talent.earthen_spike.enabled|(cooldown.earthen_spike.remains>1&cooldown.doom_winds.remains>1)|debuff.earthen_spike.up)
A 0.00 call_action_list,name=buffs
B 0.00 call_action_list,name=CDs
C 0.00 call_action_list,name=core
D 0.00 call_action_list,name=filler
actions.CDs
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
E 2.03 berserking,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
0.00 blood_fury,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
F 1.00 potion,if=buff.ascendance.up|!talent.ascendance.enabled&feral_spirit.remains>5|target.time_to_die<=60
G 2.97 feral_spirit
H 5.33 doom_winds,if=debuff.earthen_spike.up&talent.earthen_spike.enabled|!talent.earthen_spike.enabled
I 2.04 ascendance,if=buff.doom_winds.up
actions.buffs
# count action,conditions
J 8.20 rockbiter,if=talent.landslide.enabled&!buff.landslide.up
0.00 fury_of_air,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
K 2.48 crash_lightning,if=artifact.alpha_wolf.rank&prev_gcd.1.feral_spirit
L 6.40 flametongue,if=!buff.flametongue.up
M 8.47 frostbrand,if=talent.hailstorm.enabled&!buff.frostbrand.up&variable.furyCheck45
N 2.44 flametongue,if=buff.flametongue.remains<6+gcd&cooldown.doom_winds.remains<gcd*2
O 2.64 frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<6+gcd&cooldown.doom_winds.remains<gcd*2
actions.core
# count action,conditions
0.00 earthen_spike,if=variable.furyCheck25
0.00 crash_lightning,if=!buff.crash_lightning.up&active_enemies>=2
0.00 windsong
0.00 crash_lightning,if=active_enemies>=8|(active_enemies>=6&talent.crashing_storm.enabled)
0.00 windstrike
P 43.37 stormstrike,if=buff.stormbringer.up&variable.furyCheck25
0.00 crash_lightning,if=active_enemies>=4|(active_enemies>=2&talent.crashing_storm.enabled)
0.00 lightning_bolt,if=talent.overcharge.enabled&variable.furyCheck45&maelstrom>=40
Q 33.89 stormstrike,if=(!talent.overcharge.enabled&variable.furyCheck45)|(talent.overcharge.enabled&variable.furyCheck80)
0.00 frostbrand,if=variable.akainuAS
0.00 lava_lash,if=buff.hot_hand.react&((variable.akainuEquipped&buff.frostbrand.up)|!variable.akainuEquipped)
0.00 sundering,if=active_enemies>=3
R 14.01 crash_lightning,if=active_enemies>=3|variable.LightningCrashNotUp|variable.alphaWolfCheck
actions.filler
# count action,conditions
S 46.24 rockbiter,if=maelstrom<120
T 8.96 flametongue,if=buff.flametongue.remains<4.8
0.00 rockbiter,if=maelstrom<=40
0.00 crash_lightning,if=(talent.crashing_storm.enabled|active_enemies>=2)&debuff.earthen_spike.up&maelstrom>=40&variable.OCPool60
U 7.66 frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<4.8&maelstrom>40
0.00 frostbrand,if=variable.akainuEquipped&!buff.frostbrand.up&maelstrom>=75
0.00 sundering
V 35.33 lava_lash,if=maelstrom>=50&variable.OCPool70&variable.furyCheck80
0.00 rockbiter
W 4.24 crash_lightning,if=(maelstrom>=65|talent.crashing_storm.enabled|active_enemies>=2)&variable.OCPool60&variable.furyCheck45
X 1.73 flametongue
actions.opener
# count action,conditions
Y 0.83 rockbiter,if=maelstrom<15&time<2

Sample Sequence

012467YLMGKEHI99S9999R9V999T9U9J9VQSVPQSSPQRSTUVPQSSVVV999S9997R9TQSMVPPQSVSVTPOQHPPPQJRSVSVVPQSPLMPQSRSV7XSP999FU9V9V999J9R9T9U9V999J999NOGKHQ999J99799VQSTURVSVPQSSVQSTPQSPPMPQPQSPR999999L997JMPQSRNHI9ES9V9999U99999JQRSTVSUSVVQSVPQPQRSL7SPPQMSVPPSPPR9L9S9G9M999N9J9HR99QP9

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask T19 4pc - T20 2pc 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom
Pre precombat 1 food T19 4pc - T20 2pc 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom
Pre precombat 2 augmentation T19 4pc - T20 2pc 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom potion_of_prolonged_power
0:00.000 default 6 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom potion_of_prolonged_power
0:00.000 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/150: 3% maelstrom potion_of_prolonged_power
0:00.000 opener Y rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/150: 3% maelstrom potion_of_prolonged_power
0:01.107 buffs L flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/150: 26% maelstrom bloodlust, stormbringer, landslide, wind_strikes, shock_of_the_twisting_nether, potion_of_prolonged_power
0:01.957 buffs M frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/150: 26% maelstrom bloodlust, flametongue, stormbringer, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, potion_of_prolonged_power
0:02.810 CDs G feral_spirit Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/150: 19% maelstrom bloodlust, flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:03.660 buffs K crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/150: 29% maelstrom bloodlust, flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:04.510 CDs E berserking Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/150: 26% maelstrom bloodlust, flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:04.510 CDs H doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/150: 26% maelstrom bloodlust, berserking, flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:04.510 CDs I ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/150: 26% maelstrom bloodlust, berserking, flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:04.510 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/150: 26% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:05.265 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/150: 65% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:06.019 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/150: 79% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:06.775 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:07.529 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:08.284 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:09.038 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:09.794 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:10.546 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, wind_strikes, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:11.301 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:12.055 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 145.0/150: 97% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:12.808 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:13.563 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:14.317 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:15.071 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:15.967 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:16.818 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, ascendance, flametongue, frostbrand, unleash_doom, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:17.669 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, ascendance, flametongue, frostbrand, unleash_doom, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:18.519 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:19.370 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 147.0/150: 98% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, unleash_doom, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:20.220 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 127.0/150: 85% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:21.072 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/150: 61% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:21.924 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 126.0/150: 84% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:22.774 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/150: 67% maelstrom bloodlust, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:23.626 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/150: 57% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:24.477 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/150: 34% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:25.327 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:26.179 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 138.0/150: 92% maelstrom bloodlust, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:27.031 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 137.0/150: 91% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:27.883 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/150: 81% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:28.735 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/150: 67% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:29.585 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:30.436 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:31.289 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:32.141 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/150: 83% maelstrom bloodlust, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:32.992 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/150: 73% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:33.845 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/150: 49% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:34.696 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/150: 69% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:35.547 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 142.0/150: 95% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:36.399 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/150: 78% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:37.252 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/150: 65% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:38.102 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/150: 48% maelstrom bloodlust, ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:38.953 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/150: 49% maelstrom bloodlust, ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:39.805 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/150: 62% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:40.656 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/150: 69% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:41.509 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 138.0/150: 92% maelstrom ascendance, flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:42.755 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:43.860 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, landslide, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:44.966 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 147.0/150: 98% maelstrom ascendance, flametongue, frostbrand, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:44.966 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 147.0/150: 98% maelstrom ascendance, flametongue, frostbrand, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:46.070 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 137.0/150: 91% maelstrom ascendance, flametongue, frostbrand, landslide, wind_strikes, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:47.174 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 134.0/150: 89% maelstrom ascendance, flametongue, frostbrand, landslide, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:48.280 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 139.0/150: 93% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:49.387 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/150: 79% maelstrom flametongue, frostbrand, landslide, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:50.492 buffs M frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, landslide, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:51.597 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom flametongue, frostbrand, landslide, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:52.701 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/150: 83% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:53.806 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 128.0/150: 85% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:54.913 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/150: 75% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:56.018 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/150: 55% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:57.125 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 131.0/150: 87% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:58.231 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/150: 71% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
0:59.335 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:00.439 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom flametongue, frostbrand, landslide, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:01.545 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:02.651 buffs O frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 129.0/150: 86% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:03.756 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/150: 76% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:04.862 CDs H doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/150: 53% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:04.862 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/150: 53% maelstrom flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:05.968 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/150: 52% maelstrom flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:07.073 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/150: 64% maelstrom flametongue, frostbrand, stormbringer, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:08.177 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:09.282 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/150: 49% maelstrom flametongue, frostbrand, doom_winds, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:10.387 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/150: 69% maelstrom flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:11.493 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/150: 59% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:12.598 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/150: 81% maelstrom flametongue, frostbrand, landslide, wind_strikes, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:13.703 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/150: 74% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:14.809 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 145.0/150: 97% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:15.913 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:17.020 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:18.127 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:19.234 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/150: 39% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:20.340 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/150: 65% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:21.446 buffs L flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/150: 55% maelstrom frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:22.550 buffs M frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/150: 59% maelstrom flametongue, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:23.657 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/150: 49% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:24.764 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/150: 39% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:25.870 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/150: 12% maelstrom flametongue, frostbrand, landslide, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:26.976 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/150: 35% maelstrom flametongue, frostbrand, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:28.081 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/150: 21% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:29.186 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/150: 44% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:30.292 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/150: 27% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:30.292 filler X flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/150: 27% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:31.400 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:32.505 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/150: 66% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:33.610 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/150: 65% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:34.717 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/150: 79% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:35.822 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 133.0/150: 89% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:36.928 CDs F potion Fluffy_Pillow 220000.0/220000: 100% mana | 144.0/150: 96% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:36.928 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 144.0/150: 96% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:38.033 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 134.0/150: 89% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:39.139 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 145.0/150: 97% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:40.244 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:41.348 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/150: 81% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:42.454 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/150: 65% maelstrom ascendance, flametongue, frostbrand, unleash_doom, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:43.560 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/150: 72% maelstrom ascendance, flametongue, frostbrand, stormbringer, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:44.667 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/150: 82% maelstrom ascendance, flametongue, frostbrand, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:45.773 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 139.0/150: 93% maelstrom ascendance, flametongue, frostbrand, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:46.879 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:47.984 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:49.089 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:50.195 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 132.0/150: 88% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:51.301 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 137.0/150: 91% maelstrom ascendance, flametongue, frostbrand, landslide, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:52.406 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 134.0/150: 89% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:53.511 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/150: 79% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:54.617 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/150: 81% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:55.722 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/150: 64% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:56.829 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/150: 81% maelstrom ascendance, flametongue, frostbrand, stormbringer, unleash_doom, wind_strikes, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:57.934 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 127.0/150: 85% maelstrom ascendance, flametongue, frostbrand, unleash_doom, wind_strikes, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:59.039 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/150: 83% maelstrom ascendance, flametongue, frostbrand, unleash_doom, wind_strikes, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:00.145 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:01.251 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:02.355 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:03.461 buffs N flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:04.568 buffs O frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:05.672 CDs G feral_spirit Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:06.778 buffs K crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 145.0/150: 97% maelstrom flametongue, frostbrand, landslide, unleash_doom, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:07.882 CDs H doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 145.0/150: 97% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:07.882 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 145.0/150: 97% maelstrom flametongue, frostbrand, landslide, doom_winds, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:08.986 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 134.0/150: 89% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:10.092 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, stormbringer, doom_winds, unleash_doom, wind_strikes, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:11.197 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, doom_winds, unleash_doom, wind_strikes, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:12.302 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, doom_winds, unleash_doom, wind_strikes, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:13.408 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:14.513 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:15.618 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:15.618 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:16.723 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, landslide, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:17.829 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, landslide, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:18.936 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom flametongue, frostbrand, landslide, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:20.041 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, landslide, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:21.145 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:22.249 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:23.355 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom flametongue, frostbrand, landslide, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:24.458 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:25.563 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:26.668 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 129.0/150: 86% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:27.773 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/150: 73% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:28.877 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/150: 63% maelstrom flametongue, frostbrand, landslide, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:29.983 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/150: 43% maelstrom flametongue, frostbrand, landslide, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:31.088 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/150: 62% maelstrom flametongue, frostbrand, landslide, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:32.193 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 127.0/150: 85% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:33.298 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/150: 71% maelstrom flametongue, frostbrand, landslide, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:34.403 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/150: 48% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:35.508 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/150: 67% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:36.614 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/150: 74% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:37.719 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/150: 64% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:38.826 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/150: 41% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:39.930 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:41.035 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/150: 72% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:42.139 buffs M frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/150: 71% maelstrom flametongue, stormbringer, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:43.245 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/150: 61% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:44.351 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/150: 48% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:45.456 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/150: 37% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:46.562 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/150: 27% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:47.668 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/150: 1% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:48.771 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:49.878 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/150: 26% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:50.983 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/150: 16% maelstrom ascendance, flametongue, frostbrand, landslide, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:52.089 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/150: 17% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:53.195 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/150: 27% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:54.301 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/150: 28% maelstrom ascendance, flametongue, frostbrand, landslide, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:55.407 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/150: 39% maelstrom ascendance, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:56.512 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/150: 39% maelstrom ascendance, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:57.617 buffs L flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/150: 59% maelstrom ascendance, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:58.722 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/150: 63% maelstrom ascendance, flametongue, stormbringer, unleash_doom, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:59.828 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom ascendance, flametongue, stormbringer, unleash_doom, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:00.934 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/150: 64% maelstrom flametongue, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:00.934 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/150: 64% maelstrom flametongue, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:02.039 buffs M frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom flametongue, landslide, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:03.145 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:04.251 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/150: 79% maelstrom flametongue, frostbrand, landslide, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:05.357 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/150: 56% maelstrom flametongue, frostbrand, landslide, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:06.462 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/150: 82% maelstrom flametongue, frostbrand, landslide, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:07.566 buffs N flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/150: 69% maelstrom flametongue, frostbrand, landslide, wind_strikes, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:08.672 CDs H doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/150: 69% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:08.672 CDs I ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/150: 69% maelstrom flametongue, frostbrand, landslide, doom_winds, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:08.672 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/150: 69% maelstrom ascendance, flametongue, frostbrand, landslide, doom_winds, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:09.778 CDs E berserking Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/150: 76% maelstrom ascendance, flametongue, frostbrand, landslide, doom_winds, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:09.778 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/150: 76% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:10.740 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:11.701 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:12.663 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 139.0/150: 93% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:13.624 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom berserking, ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:14.586 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom berserking, ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:15.548 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:16.510 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 147.0/150: 98% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:17.471 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 137.0/150: 91% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:18.432 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 148.0/150: 99% maelstrom berserking, ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, chill_of_the_twisting_nether
3:19.393 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 149.0/150: 99% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, chill_of_the_twisting_nether
3:20.353 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, stormbringer, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, chill_of_the_twisting_nether
3:21.460 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, chill_of_the_twisting_nether
3:22.567 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 147.0/150: 98% maelstrom ascendance, flametongue, frostbrand, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, chill_of_the_twisting_nether
3:23.674 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:24.780 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:25.885 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, landslide, unleash_doom, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:26.992 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 129.0/150: 86% maelstrom flametongue, frostbrand, landslide, unleash_doom, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:28.097 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 129.0/150: 86% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:29.203 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/150: 69% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:30.309 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 138.0/150: 92% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:31.414 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/150: 79% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:32.518 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:33.621 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:34.726 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:35.830 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/150: 49% maelstrom flametongue, frostbrand, landslide, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:36.936 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/150: 69% maelstrom flametongue, frostbrand, landslide, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:38.040 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/150: 52% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:39.146 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/150: 42% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:40.252 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/150: 28% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:41.358 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/150: 27% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:42.463 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:43.568 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:44.674 buffs L flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/150: 29% maelstrom frostbrand, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:45.779 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/150: 36% maelstrom flametongue, frostbrand, landslide, unleash_doom, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:45.779 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/150: 36% maelstrom flametongue, frostbrand, landslide, unleash_doom, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:46.885 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/150: 59% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:47.990 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/150: 58% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:49.096 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/150: 57% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:50.200 buffs M frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/150: 31% maelstrom flametongue, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:51.305 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/150: 21% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:52.412 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, landslide, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:53.518 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:54.624 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:55.729 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:56.833 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/150: 29% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:57.938 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/150: 32% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:59.042 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/150: 22% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:00.145 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/150: 21% maelstrom ascendance, flametongue, frostbrand, landslide, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:01.253 buffs L flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/150: 32% maelstrom ascendance, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:02.358 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/150: 35% maelstrom ascendance, flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:03.463 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom ascendance, flametongue, frostbrand, landslide, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:04.568 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/150: 59% maelstrom ascendance, flametongue, frostbrand, landslide, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:05.673 CDs G feral_spirit Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/150: 57% maelstrom ascendance, flametongue, frostbrand, landslide, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:06.779 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/150: 67% maelstrom ascendance, flametongue, landslide, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:07.885 buffs M frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 136.0/150: 91% maelstrom ascendance, flametongue, landslide, unleash_doom, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:08.992 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 131.0/150: 87% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:10.097 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:11.204 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:12.309 buffs N flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:13.414 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, landslide, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:14.520 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:15.625 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:16.730 CDs H doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:16.730 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, landslide, doom_winds, unleash_doom, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:17.836 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, unleash_doom, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:18.941 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:20.046 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:21.150 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:22.255 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 149.0/150: 99% maelstrom ascendance, flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4728 4403 0
Agility 44332 38901 28018 (24626)
Stamina 81377 81377 45295
Intellect 7649 7324 0
Spirit 1 1 0
Health 4882620 4882620 0
Mana 220000 220000 0
Maelstrom 150 150 0
Spell Power 53198 46681 0
Crit 18.60% 18.60% 3439
Haste 36.17% 36.17% 13565
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 44332 38901 0
Mastery 60.58% 60.58% 8916
Armor 3282 3282 3282
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 939.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of the Skybreaker
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +871 Crit, +515 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Flesh-Raking Leggings
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Mastery }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }, gems: { +150 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Eye of the Twisting Nether
ilevel: 970, stats: { +3515 Sta, +2884 Haste, +1602 Mastery }, gems: { +200 Agi }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Specter of Betrayal
ilevel: 940, stats: { +2994 StrAgi }
Local Trinket2 Cradle of Anguish
ilevel: 930, stats: { +1320 Haste }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Agi }
Local Main Hand Doomhammer
ilevel: 951, weapon: { 8445 - 15685, 2.6 }, stats: { +1496 Agi, +2244 Sta, +435 Crit, +418 Mastery }, relics: { +67 ilevels, +67 ilevels, +67 ilevels }
Local Off Hand Fury of the Stonemother
ilevel: 951, weapon: { 8445 - 15685, 2.6 }, stats: { +1496 Agi, +2244 Sta, +435 Crit, +418 Mastery }

Talents

Level
15 Windsong (Enhancement Shaman) Hot Hand (Enhancement Shaman) Landslide (Enhancement Shaman)
30 Rainfall (Enhancement Shaman) Feral Lunge (Enhancement Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Lightning Shield (Enhancement Shaman) Ancestral Swiftness Hailstorm (Enhancement Shaman)
75 Tempest (Enhancement Shaman) Overcharge (Enhancement Shaman) Empowered Stormlash (Enhancement Shaman)
90 Crashing Storm (Enhancement Shaman) Fury of Air (Enhancement Shaman) Sundering (Enhancement Shaman)
100 Ascendance (Enhancement Shaman) Boulderfist (Enhancement Shaman) Earthen Spike (Enhancement Shaman)

Profile

shaman="T19 4pc - T20 2pc"
spec=enhancement
level=110
race=troll
role=attack
position=back
talents=3133111
artifact=41:0:0:0:0:899:1:900:1:901:1:902:1:903:1:904:1:905:4:906:4:907:4:908:4:909:4:910:4:911:4:912:4:913:4:930:1:1351:1:1388:1:1593:4:1594:1:1595:1:1596:1:1687:1

# Default consumables
potion=prolonged_power
flask=seventh_demon
food=lavish_suramar_feast
augmentation=defiled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/lightning_shield

# Executed every time the actor is available.
actions=wind_shear
actions+=/variable,name=hailstormCheck,value=((talent.hailstorm.enabled&!buff.frostbrand.up)|!talent.hailstorm.enabled)
actions+=/variable,name=furyCheck80,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>80))
actions+=/variable,name=furyCheck70,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>70))
actions+=/variable,name=furyCheck45,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>45))
actions+=/variable,name=furyCheck25,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>25))
actions+=/variable,name=OCPool70,value=(!talent.overcharge.enabled|(talent.overcharge.enabled&maelstrom>70))
actions+=/variable,name=OCPool60,value=(!talent.overcharge.enabled|(talent.overcharge.enabled&maelstrom>60))
actions+=/variable,name=heartEquipped,value=(equipped.151819)
actions+=/variable,name=akainuEquipped,value=(equipped.137084)
actions+=/variable,name=akainuAS,value=(variable.akainuEquipped&buff.hot_hand.react&!buff.frostbrand.up)
actions+=/variable,name=LightningCrashNotUp,value=(!buff.lightning_crash.up&set_bonus.tier20_2pc)
actions+=/variable,name=alphaWolfCheck,value=((pet.frost_wolf.buff.alpha_wolf.remains<2&pet.fiery_wolf.buff.alpha_wolf.remains<2&pet.lightning_wolf.buff.alpha_wolf.remains<2)&feral_spirit.remains>4)
actions+=/auto_attack
actions+=/use_items
actions+=/call_action_list,name=opener
actions+=/windstrike,if=(variable.heartEquipped|set_bonus.tier19_2pc)&(!talent.earthen_spike.enabled|(cooldown.earthen_spike.remains>1&cooldown.doom_winds.remains>1)|debuff.earthen_spike.up)
actions+=/call_action_list,name=buffs
actions+=/call_action_list,name=CDs
actions+=/call_action_list,name=core
actions+=/call_action_list,name=filler

actions.CDs=bloodlust,if=target.health.pct<25|time>0.500
actions.CDs+=/berserking,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
actions.CDs+=/blood_fury,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
actions.CDs+=/potion,if=buff.ascendance.up|!talent.ascendance.enabled&feral_spirit.remains>5|target.time_to_die<=60
actions.CDs+=/feral_spirit
actions.CDs+=/doom_winds,if=debuff.earthen_spike.up&talent.earthen_spike.enabled|!talent.earthen_spike.enabled
actions.CDs+=/ascendance,if=buff.doom_winds.up

actions.buffs=rockbiter,if=talent.landslide.enabled&!buff.landslide.up
actions.buffs+=/fury_of_air,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
actions.buffs+=/crash_lightning,if=artifact.alpha_wolf.rank&prev_gcd.1.feral_spirit
actions.buffs+=/flametongue,if=!buff.flametongue.up
actions.buffs+=/frostbrand,if=talent.hailstorm.enabled&!buff.frostbrand.up&variable.furyCheck45
actions.buffs+=/flametongue,if=buff.flametongue.remains<6+gcd&cooldown.doom_winds.remains<gcd*2
actions.buffs+=/frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<6+gcd&cooldown.doom_winds.remains<gcd*2

actions.core=earthen_spike,if=variable.furyCheck25
actions.core+=/crash_lightning,if=!buff.crash_lightning.up&active_enemies>=2
actions.core+=/windsong
actions.core+=/crash_lightning,if=active_enemies>=8|(active_enemies>=6&talent.crashing_storm.enabled)
actions.core+=/windstrike
actions.core+=/stormstrike,if=buff.stormbringer.up&variable.furyCheck25
actions.core+=/crash_lightning,if=active_enemies>=4|(active_enemies>=2&talent.crashing_storm.enabled)
actions.core+=/lightning_bolt,if=talent.overcharge.enabled&variable.furyCheck45&maelstrom>=40
actions.core+=/stormstrike,if=(!talent.overcharge.enabled&variable.furyCheck45)|(talent.overcharge.enabled&variable.furyCheck80)
actions.core+=/frostbrand,if=variable.akainuAS
actions.core+=/lava_lash,if=buff.hot_hand.react&((variable.akainuEquipped&buff.frostbrand.up)|!variable.akainuEquipped)
actions.core+=/sundering,if=active_enemies>=3
actions.core+=/crash_lightning,if=active_enemies>=3|variable.LightningCrashNotUp|variable.alphaWolfCheck

actions.filler=rockbiter,if=maelstrom<120
actions.filler+=/flametongue,if=buff.flametongue.remains<4.8
actions.filler+=/rockbiter,if=maelstrom<=40
actions.filler+=/crash_lightning,if=(talent.crashing_storm.enabled|active_enemies>=2)&debuff.earthen_spike.up&maelstrom>=40&variable.OCPool60
actions.filler+=/frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<4.8&maelstrom>40
actions.filler+=/frostbrand,if=variable.akainuEquipped&!buff.frostbrand.up&maelstrom>=75
actions.filler+=/sundering
actions.filler+=/lava_lash,if=maelstrom>=50&variable.OCPool70&variable.furyCheck80
actions.filler+=/rockbiter
actions.filler+=/crash_lightning,if=(maelstrom>=65|talent.crashing_storm.enabled|active_enemies>=2)&variable.OCPool60&variable.furyCheck45
actions.filler+=/flametongue

actions.opener=rockbiter,if=maelstrom<15&time<2

head=helmet_of_the_skybreaker,id=147178,bonus_id=1512/3563
neck=string_of_extracted_incisors,id=147013,bonus_id=1512/3563,enchant_id=5439
shoulders=pauldrons_of_the_skybreaker,id=147180,bonus_id=1512/3563
back=drape_of_the_skybreaker,id=147176,bonus_id=1512/3563,enchant_id=5435
chest=harness_of_the_skybreaker,id=147175,bonus_id=1512/3563
wrists=painsinged_armguards,id=147057,bonus_id=1512/3563
hands=smoldering_heart,id=151819,bonus_id=3570
waist=waistguard_of_interminable_unity,id=147056,bonus_id=1512/3563
legs=fleshraking_leggings,id=147051,bonus_id=1512/3563
feet=starstalker_treads,id=147046,bonus_id=1522/3563,gem_id=130222
finger1=eye_of_the_twisting_nether,id=137050,bonus_id=3570,gem_id=130247,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,bonus_id=1512/3563,enchant=200haste
trinket1=specter_of_betrayal,id=151190,bonus_id=1522/3563
trinket2=cradle_of_anguish,id=147010,bonus_id=1512/3563
main_hand=doomhammer,id=128819,bonus_id=745,gem_id=147088/147100/147115,relic_id=1512:3563/1512:3563/1512:3563
off_hand=fury_of_the_stonemother,id=128873,gem_id=0/0/0/0,relic_id=0/0

# Gear Summary
# gear_ilvl=938.88
# gear_agility=28018
# gear_stamina=45295
# gear_crit_rating=3439
# gear_haste_rating=13565
# gear_mastery_rating=8916
# gear_versatility_rating=2624
# gear_armor=3282
# set_bonus=tier19_2pc=1
# set_bonus=tier19_4pc=1
# set_bonus=tier20_2pc=1

T20 2pc : 1302683 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1302682.8 1302682.8 2672.5 / 0.205% 267984.0 / 20.6% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.42% 60.6 100.1% 100%
Talents
  • 15: Landslide (Enhancement Shaman)
  • 30: Rainfall (Enhancement Shaman)
  • 45: Voodoo Totem
  • 60: Hailstorm (Enhancement Shaman)
  • 75: Tempest (Enhancement Shaman)
  • 90: Crashing Storm (Enhancement Shaman)
  • 100: Ascendance (Enhancement Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
T20 2pc 1302683
Crash Lightning 16120 (26103) 1.2% (2.0%) 21.3 14.22sec 369099 348428 Direct 21.3 189142 378440 227922 20.5% 0.0%  

Stats details: crash_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.33 21.33 0.00 0.00 1.0594 0.0000 4862538.54 4862538.54 0.00 348427.58 348427.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.96 79.50% 189141.94 179239 202409 189235.59 183897 196738 3207821 3207821 0.00
crit 4.37 20.50% 378440.15 358479 404819 373703.80 0 404819 1654718 1654718 0.00
 
 

Action details: crash_lightning

Static Values
  • id:187874
  • school:nature
  • resource:maelstrom
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:artifact.alpha_wolf.rank&prev_gcd.1.feral_spirit
Spelldata
  • id:187874
  • name:Crash Lightning
  • school:nature
  • tooltip:Stormstrike and Lava Lash deal an additional $195592sw1 damage to all targets in front of you.
  • description:Electrocutes all enemies in front of you, dealing $sw1 Nature damage. Hitting 2 or more targets enhances your weapons for {$187878d=10 seconds}, causing Stormstrike and Lava Lash to also deal $195592sw1 Nature damage to all targets in front of you.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.50
 
    Crashing Storm 9983 0.8% 147.9 2.00sec 20359 0 Direct 147.9 16492 32984 20359 23.4% 0.0%  

Stats details: crashing_storm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 147.90 147.90 0.00 0.00 0.0000 0.0000 3011227.97 3011227.97 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 113.22 76.55% 16492.28 14519 18094 16500.67 16069 17121 1867312 1867312 0.00
crit 34.68 23.45% 32984.26 29037 36187 33000.70 31815 34835 1143916 1143916 0.00
 
 

Action details: crashing_storm

Static Values
  • id:210801
  • school:nature
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210801
  • name:Crashing Storm
  • school:nature
  • tooltip:
  • description:{$@spelldesc192246=Crash Lightning also electrifies the ground, leaving an electrical field behind which damages enemies within it for ${7*{$210801s1=1}} Nature damage over {$210797d=6 seconds}. }
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.160000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Dread Torrent 40569 3.1% 53.0 10.59sec 230382 0 Direct 53.0 187685 375455 230382 22.7% 0.0%  

Stats details: dread_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.98 52.98 0.00 0.00 0.0000 0.0000 12205736.40 12205736.40 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.93 77.26% 187684.94 182405 187918 187680.31 187104 187918 7682528 7682528 0.00
crit 12.05 22.74% 375455.20 364809 375836 375450.73 372160 375836 4523209 4523209 0.00
 
 

Action details: dread_torrent

Static Values
  • id:246464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246464
  • name:Dread Torrent
  • school:shadow
  • tooltip:
  • description:{$@spelldesc246461=Create a Dread Reflection at your location for {$d=60 seconds} and cause each of your Dread Reflections to unleash a torrent of magic that deals ${{$246464s1=39731 to 43913}*4} Shadow damage over {$246463d=3 seconds}, split evenly among nearby enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:140074.50
  • base_dd_max:154819.18
 
Flametongue 15449 (68236) 1.2% (5.2%) 19.7 15.62sec 1041372 982014 Direct 19.7 192240 384374 236469 23.0% 0.0%  

Stats details: flametongue

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.65 19.65 0.00 0.00 1.0605 0.0000 4646950.06 4646950.06 0.00 982014.08 982014.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.13 76.98% 192240.19 179999 210826 192315.12 186621 201541 2907963 2907963 0.00
crit 4.52 23.02% 384373.74 359999 421651 381336.89 0 421651 1738987 1738987 0.00
 
 

Action details: flametongue

Static Values
  • id:193796
  • school:fire
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!buff.flametongue.up
Spelldata
  • id:193796
  • name:Flametongue
  • school:fire
  • tooltip:
  • description:Scorches your target, dealing {$s2=1} Fire damage, and enhances your weapons with fire for {$194084d=16 seconds}, causing each weapon attack to deal up to ${$<coeff>*$AP} Fire damage, based on weapon speed.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Flametongue Attack 52788 4.1% 906.3 0.60sec 17453 0 Direct 906.3 14187 28377 17453 23.0% 0.0%  

Stats details: flametongue_attack

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 906.25 906.25 0.00 0.00 0.0000 0.0000 15817241.43 15817241.43 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 697.64 76.98% 14187.13 12293 15550 14191.95 13870 14630 9897523 9897523 0.00
crit 208.61 23.02% 28376.75 24586 31099 28385.79 27734 29203 5919718 5919718 0.00
 
 

Action details: flametongue_attack

Static Values
  • id:10444
  • school:fire
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:{$@spelldesc193796=Scorches your target, dealing {$s2=1} Fire damage, and enhances your weapons with fire for {$194084d=16 seconds}, causing each weapon attack to deal up to ${$<coeff>*$AP} Fire damage, based on weapon speed.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Frostbrand 9130 (124992) 0.7% (9.6%) 18.8 16.28sec 1989971 1875829 Direct 18.8 118655 237443 145744 22.8% 0.0%  

Stats details: frostbrand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.83 18.83 87.30 0.00 1.0609 3.3018 2744454.05 2744454.05 0.00 121574.43 1875828.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.54 77.19% 118655.22 111001 130010 118702.39 114473 124364 1724684 1724684 0.00
crit 4.29 22.81% 237442.75 222001 260020 235551.01 0 260020 1019770 1019770 0.00
 
 

Action details: frostbrand

Static Values
  • id:196834
  • school:frost
  • resource:maelstrom
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.hailstorm.enabled&!buff.frostbrand.up&variable.furyCheck45
Spelldata
  • id:196834
  • name:Frostbrand
  • school:frost
  • tooltip:Melee attacks reduce target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
  • description:Chills your target, dealing {$s1=1} Frost damage and reducing the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}, and enhances your weapons with frost for {$d=16 seconds}, causing each weapon attack to reduce the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.925000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.00
  • base_tick_time:5.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Hailstorm 115862 8.9% 896.0 0.60sec 38758 0 Direct 896.0 31500 63007 38758 23.0% 0.0%  

Stats details: hailstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 896.00 896.00 0.00 0.00 0.0000 0.0000 34727096.35 34727096.35 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 689.59 76.96% 31499.61 27837 33735 31507.38 30979 32188 21721696 21721696 0.00
crit 206.41 23.04% 63006.55 55675 67470 63022.52 61937 64407 13005400 13005400 0.00
 
 

Action details: hailstorm

Static Values
  • id:210854
  • school:frost
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210854
  • name:Hailstorm
  • school:frost
  • tooltip:
  • description:{$@spelldesc210853=Frostbrand now also enhances your weapon's damage, causing each of your weapon attacks to also deal $210854sw1 Frost damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.30
 
Lava Lash 104276 (115793) 8.1% (8.9%) 38.3 7.45sec 911308 859527 Direct 38.3 663657 1321314 820578 23.9% 0.0%  

Stats details: lava_lash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.29 38.29 0.00 0.00 1.0603 0.0000 31417361.21 31417361.21 0.00 859526.52 859526.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.15 76.14% 663656.57 448188 1478679 670451.58 539734 940504 19347094 19347094 0.00
crit 9.14 23.86% 1321314.25 909823 2957357 1334444.98 0 2626918 12070267 12070267 0.00
 
 

Action details: lava_lash

Static Values
  • id:60103
  • school:fire
  • resource:maelstrom
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.hot_hand.react&((variable.akainuEquipped&buff.frostbrand.up)|!variable.akainuEquipped)
Spelldata
  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing $sw1 Fire damage.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:7.81
 
    Doom Vortex (_ll) 11517 0.9% 45.7 5.75sec 76112 0 Direct 45.7 61841 123692 76109 23.1% 0.0%  

Stats details: doom_vortex_ll

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.66 45.66 0.00 0.00 0.0000 0.0000 3475117.82 3475117.82 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.12 76.93% 61841.25 53634 67845 61872.21 58633 66179 2172122 2172122 0.00
crit 10.53 23.07% 123692.26 107269 135691 123754.42 113233 135691 1302996 1302996 0.00
 
 

Action details: doom_vortex_ll

Static Values
  • id:199116
  • school:fire
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:199116
  • name:Doom Vortex
  • school:fire
  • tooltip:
  • description:{$@spelldesc199107=Lava Lash{$?s210727=false}[ and Lightning Bolt have][ has] a chance to cause |cFFFFCC99Doomhammer|r to release a fiery tornado at your target's location, dealing ${3*{$199116s1=1}} Fire damage over {$199121d=3 seconds} to enemies within $199116A1 yards.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.600000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
main_hand 19652 1.5% 133.2 2.26sec 44520 28243 Direct 133.2 42784 85559 44519 23.0% 18.9%  

Stats details: main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 133.17 133.17 0.00 0.00 1.5763 0.0000 5928823.90 8715932.73 31.98 28243.12 28243.12
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.33 58.07% 42784.42 37865 46041 42797.92 41797 44128 3308490 4863794 31.98
crit 30.63 23.00% 85558.75 76867 92082 85586.83 83347 88354 2620334 3852139 31.98
miss 25.22 18.93% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Mark of the Hidden Satyr 21681 1.7% 20.6 14.61sec 316665 0 Direct 20.6 257166 514655 316681 23.1% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.57 20.57 0.00 0.00 0.0000 0.0000 6512231.64 6512231.64 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.81 76.89% 257166.09 223468 282681 257226.29 245102 273334 4066529 4066529 0.00
crit 4.75 23.11% 514655.46 446936 565361 510164.16 0 565361 2445703 2445703 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
offhand 9790 0.8% 132.6 2.26sec 22272 14079 Direct 132.6 21408 42806 22272 23.0% 18.9%  

Stats details: offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 132.65 132.65 0.00 0.00 1.5820 0.0000 2954288.68 4343084.20 31.98 14078.63 14078.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.01 58.06% 21407.74 18933 23021 21414.61 20862 22064 1648692 2423733 31.98
crit 30.50 22.99% 42805.93 38433 46041 42821.12 41477 44490 1305597 1919351 31.98
miss 25.13 18.95% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: offhand

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Rockbiter 101199 7.8% 56.2 5.31sec 542640 507319 Direct 56.2 440221 880980 542630 23.2% 0.0%  

Stats details: rockbiter

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.22 56.22 0.00 0.00 1.0696 0.0000 30507141.74 30507141.74 0.00 507319.35 507319.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.16 76.76% 440221.44 406397 483136 440429.70 430357 454525 18998392 18998392 0.00
crit 13.06 23.24% 880980.41 800782 966273 881553.07 842853 953051 11508750 11508750 0.00
 
 

Action details: rockbiter

Static Values
  • id:193786
  • school:nature
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.landslide.enabled&!buff.landslide.up
Spelldata
  • id:193786
  • name:Rockbiter
  • school:nature
  • tooltip:
  • description:Assaults your target with earthen power, dealing {$s1=0} Nature damage. |cFFFFFFFFGenerates {$s2=25} Maelstrom.|r
 
Stormlash 39239 3.0% 696.7 1.09sec 16916 0 Direct 696.7 16916 0 16916 0.0% 0.0%  

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 696.68 696.68 0.00 0.00 0.0000 0.0000 11784978.47 11784978.47 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 696.68 100.00% 16915.79 2703 108685 16918.76 14591 19191 11784978 11784978 0.00
 
 

Action details: stormlash

Static Values
  • id:213307
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:213307
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:{$@spelldesc195255=While your weapons are enhanced, your attacks have a chance to grant Stormlash to up to {$?s210731=false}[${$m1+$210731m1}][{$s1=2}] party or raid members for {$195222d=8 seconds}, causing attacks and spellcasts to deal additional Nature damage.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:2.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14381.76
  • base_dd_max:14381.76
 
Stormstrike 0 (241011) 0.0% (18.6%) 73.8 3.76sec 983228 911566

Stats details: stormstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.83 0.00 0.00 0.00 1.0786 0.0000 0.00 0.00 0.00 911566.31 911566.31
 
 

Action details: stormstrike

Static Values
  • id:17364
  • school:physical
  • resource:maelstrom
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.stormbringer.up&variable.furyCheck25
Spelldata
  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of ${$32175sw1+$32176sw1} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
    Stormstrike (_mh) 160738 12.4% 92.1 3.76sec 525417 0 Direct 92.1 332551 808215 525396 40.5% 0.0%  

Stats details: stormstrike_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.15 92.15 0.00 0.00 0.0000 0.0000 48416887.54 71177410.86 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 54.79 59.46% 332551.38 136669 520883 333152.72 277801 387604 18222045 26788132 31.98
crit 37.36 40.54% 808214.55 273338 1041766 809003.10 692630 900023 30194843 44389279 31.98
 
 

Action details: stormstrike_mh

Static Values
  • id:32175
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of ${$32175sw1+$32176sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:7.50
 
    Stormstrike Off-Hand 80273 6.2% 92.1 3.76sec 262393 0 Direct 92.1 166545 403473 262388 40.4% 0.0%  

Stats details: stormstrike_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.15 92.15 0.00 0.00 0.0000 0.0000 24179341.77 35545922.72 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 54.88 59.55% 166545.26 68334 260441 166864.69 134556 197469 9140124 13436849 31.98
crit 37.27 40.45% 403472.57 136669 520883 403840.18 335566 455657 15039217 22109074 31.98
 
 

Action details: stormstrike_offhand

Static Values
  • id:32176
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of ${$32175sw1+$32176sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:7.50
 
Unleash Lava 46949 3.6% 127.0 3.18sec 110326 0 Direct 125.5 90877 181831 111678 22.9% 0.0%  

Stats details: unleash_lava

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 127.00 125.47 0.00 0.00 0.0000 0.0000 14011787.82 14011787.82 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 96.78 77.14% 90876.94 78663 99506 90909.38 87146 94585 8795244 8795244 0.00
crit 28.69 22.86% 181831.21 157326 199012 181904.69 172034 194008 5216544 5216544 0.00
 
 

Action details: unleash_lava

Static Values
  • id:199053
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:1.2000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:199053
  • name:Unleash Lava
  • school:fire
  • tooltip:
  • description:{$@spelldesc198736=Stormstrike has a chance to unleash the power of |cFFFFCC99Doomhammer|r, causing your special attacks to heave molten lava or lightning spikes at your target for {$199053s1=1} Fire or Nature damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.800000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Unleash Lightning 47067 3.6% 127.3 3.18sec 110334 0 Direct 125.8 90854 181758 111671 22.9% 0.0%  

Stats details: unleash_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 127.35 125.82 0.00 0.00 0.0000 0.0000 14050548.98 14050548.98 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 97.01 77.10% 90854.47 77500 99506 90884.82 87948 94839 8813584 8813584 0.00
crit 28.81 22.90% 181757.88 157326 199012 181816.52 171254 193031 5236965 5236965 0.00
 
 

Action details: unleash_lightning

Static Values
  • id:199054
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:1.2000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:199054
  • name:Unleash Lightning
  • school:nature
  • tooltip:
  • description:{$@spelldesc198736=Stormstrike has a chance to unleash the power of |cFFFFCC99Doomhammer|r, causing your special attacks to heave molten lava or lightning spikes at your target for {$199053s1=1} Fire or Nature damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.800000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Windlash (wind_lash) 14248 1.1% 54.3 4.96sec 77818 59541 Direct 54.3 63209 126485 77815 23.1% 0.0%  

Stats details: wind_lash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.33 54.33 0.00 0.00 1.3070 0.0000 4227618.11 4227618.11 0.00 59541.40 59541.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.78 76.91% 63209.00 55666 67685 63257.39 60968 66262 2641075 2641075 0.00
crit 12.54 23.09% 126484.82 113001 135370 126574.28 118028 134143 1586543 1586543 0.00
 
 

Action details: wind_lash

Static Values
  • id:114089
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114089
  • name:Windlash
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals $sw1 Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Windlash Off-Hand (wind_lash_offhand) 7124 0.5% 54.3 4.96sec 38905 29815 Direct 54.3 31603 63237 38905 23.1% 0.0%  

Stats details: wind_lash_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.32 54.32 0.00 0.00 1.3049 0.0000 2113216.43 2113216.43 0.00 29814.84 29814.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.78 76.92% 31602.54 27421 33842 31626.94 30406 33202 1320344 1320344 0.00
crit 12.54 23.08% 63237.42 56501 67685 63290.25 60076 67685 792872 792872 0.00
 
 

Action details: wind_lash_offhand

Static Values
  • id:114093
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114093
  • name:Windlash Off-Hand
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals $sw1 Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Windfury Attack 73241 5.6% 183.0 3.32sec 119730 0 Direct 183.0 97214 195159 119731 23.0% 0.0%  

Stats details: windfury_attack

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 183.02 183.02 0.00 0.00 0.0000 0.0000 21912430.70 32213348.74 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 140.94 77.01% 97214.09 55030 200065 97439.70 82638 117794 13701641 20142710 31.98
crit 42.07 22.99% 195158.66 111710 400130 195686.67 133492 265516 8210789 12070638 31.98
 
 

Action details: windfury_attack

Static Values
  • id:25504
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Each of your main hand attacks has a {$33757h=20}% chance to trigger two extra attacks, dealing $25504sw2 Physical damage each.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Windfury Attack (_oh) 14708 1.1% 38.2 14.91sec 115342 0 Direct 38.2 93596 187232 115345 23.2% 0.0%  

Stats details: windfury_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.16 38.16 0.00 0.00 0.0000 0.0000 4401306.46 6470337.40 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.30 76.78% 93596.28 83783 100032 93628.70 90287 98058 2742068 4031099 31.98
crit 8.86 23.22% 187232.02 167566 200065 187275.95 174950 200065 1659239 2439238 31.98
 
 

Action details: windfury_attack_oh

Static Values
  • id:33750
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:33750
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:$@spelldesc8232
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Windstrike 0 (249238) 0.0% (18.9%) 54.1 4.95sec 1363149 1390234

Stats details: windstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.11 0.00 0.00 0.00 0.9805 0.0000 0.00 0.00 0.00 1390234.33 1390234.33
 
 

Action details: windstrike

Static Values
  • id:115356
  • school:physical
  • resource:maelstrom
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(variable.heartEquipped|set_bonus.tier19_2pc)&(!talent.earthen_spike.enabled|(cooldown.earthen_spike.remains>1&cooldown.doom_winds.remains>1)|debuff.earthen_spike.up)
Spelldata
  • id:115356
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:Hurl a staggering blast of wind at an enemy, dealing a total of ${$115357sw1+$115360sw1} Physical damage, bypassing armor.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
    Windstrike (_mh) 166145 12.6% 67.6 4.95sec 726757 0 Direct 67.6 483592 1147928 726863 36.6% 0.0%  

Stats details: windstrike_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 67.65 67.64 0.00 0.00 0.0000 0.0000 49165089.17 49165089.17 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.87 63.38% 483592.22 187223 765747 484997.11 402383 569180 20732925 20732925 0.00
crit 24.77 36.62% 1147928.28 380063 1531494 1150545.57 880660 1337307 28432164 28432164 0.00
 
 

Action details: windstrike_mh

Static Values
  • id:115357
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115357
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of ${$115357sw1+$115360sw1} Physical damage, bypassing armor.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:7.50
 
    Windstrike Off-Hand 83093 6.3% 67.6 4.95sec 363483 0 Direct 67.6 241656 574419 363551 36.6% 0.0%  

Stats details: windstrike_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 67.65 67.64 0.00 0.00 0.0000 0.0000 24589622.33 24589622.33 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.87 63.37% 241655.71 93612 382874 242347.31 194956 285432 10359385 10359385 0.00
crit 24.77 36.63% 574419.28 190032 765747 575806.39 415183 671445 14230238 14230238 0.00
 
 

Action details: windstrike_offhand

Static Values
  • id:115360
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115360
  • name:Windstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of ${$115357sw1+$115360sw1} Physical damage, bypassing armor.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:7.50
 
pet - frost_wolf 318208 / 20092
Frozen Bite 145927 0.7% 8.3 30.13sec 332008 0 Direct 8.3 269133 536937 332003 23.5% 0.0%  

Stats details: frozen_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.35 8.35 0.00 0.00 0.0000 0.0000 2771686.45 2771686.45 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.39 76.52% 269132.82 236633 294910 268587.35 0 294910 1719338 1719338 0.00
crit 1.96 23.48% 536937.47 473265 589819 448320.59 0 589819 1052349 1052349 0.00
 
 

Action details: frozen_bite

Static Values
  • id:224126
  • school:frost
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224126
  • name:Frozen Bite
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Bite the target, causing {$s1=1} Frost damage and slowing the target's movement speed by {$s2=50}% for {$d=4 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
melee 103253 0.5% 48.3 4.65sec 40454 48118 Direct 48.3 32795 65587 40451 23.4% 0.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.32 48.32 0.00 0.00 0.8407 0.0000 1954565.02 2873395.73 31.98 48118.29 48118.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.03 76.64% 32794.51 28640 35693 32774.19 29697 35693 1214417 1785309 31.98
crit 11.28 23.36% 65587.38 57279 71386 65273.67 0 71386 740148 1088087 31.85
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Snowstorm 69028 0.3% 14.6 15.17sec 89272 0 Direct 14.6 72147 144241 89271 23.8% 0.0%  

Stats details: snowstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.61 14.61 0.00 0.00 0.0000 0.0000 1304564.38 1304564.38 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.14 76.25% 72147.30 63102 78642 71663.54 0 78642 803889 803889 0.00
crit 3.47 23.75% 144240.68 126203 157284 132964.76 0 157284 500676 500676 0.00
 
 

Action details: snowstorm

Static Values
  • id:198483
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198483
  • name:Snowstorm
  • school:frost
  • tooltip:
  • description:Deals {$s1=0} Frost damage to all targets within $A1 yards.
 
pet - fiery_wolf 403653 / 25236
Fiery Jaws 227458 1.1% 8.4 29.80sec 505999 0 Direct 8.4 179133 359146 222402 24.0% 0.0%  
Periodic 33.1 71810 0 71810 0.0% 0.0% 11.0%

Stats details: fiery_jaws

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.39 8.39 33.12 33.12 0.0000 1.0000 4243011.42 4243011.42 0.00 128121.85 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.37 75.96% 179132.64 157756 196607 178721.19 0 196607 1140998 1140998 0.00
crit 2.02 24.04% 359145.79 315511 393214 300343.18 0 393214 723898 723898 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.1 100.00% 71810.39 63103 78644 71726.04 0 78158 2378116 2378116 0.00
 
 

Action details: fiery_jaws

Static Values
  • id:224125
  • school:fire
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224125
  • name:Fiery Jaws
  • school:fire
  • tooltip:Suffering {$s2=1} Fire damage every $t sec.
  • description:Bite the target for {$s1=1} Fire damage, causing an additional $o2 Fire damage over {$d=4 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.400000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Fire Nova 70641 0.3% 14.8 14.91sec 89204 0 Direct 14.8 72115 144298 89211 23.7% 0.0%  

Stats details: fire_nova

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.75 14.75 0.00 0.00 0.0000 0.0000 1316011.48 1316011.48 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.26 76.32% 72115.39 63102 78642 71647.79 0 78642 811987 811987 0.00
crit 3.49 23.68% 144297.90 126203 157284 133088.19 0 157284 504024 504024 0.00
 
 

Action details: fire_nova

Static Values
  • id:198480
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198480
  • name:Fire Nova
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to all targets within $A1 yards.
 
melee 105554 0.5% 48.6 4.57sec 40421 48169 Direct 48.6 32783 65508 40422 23.3% 0.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.62 48.62 0.00 0.00 0.8391 0.0000 1965301.53 2889179.40 31.98 48169.16 48169.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.27 76.66% 32783.37 28640 35693 32738.16 30473 35693 1221884 1796285 31.98
crit 11.35 23.34% 65507.95 57279 71386 65236.26 0 71386 743418 1092895 31.88
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lightning_wolf 252903 / 15453
melee 149477 0.7% 48.8 4.59sec 56296 66988 Direct 48.8 45635 91321 56300 23.3% 0.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.75 48.75 0.00 0.00 0.8404 0.0000 2744439.28 4034585.71 31.98 66988.19 66988.19
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.37 76.66% 45634.84 28640 53539 45577.73 38664 51061 1705465 2507195 31.98
crit 11.38 23.34% 91321.39 57279 107079 90903.56 0 107079 1038974 1527390 31.85
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Thunder Bite 103426 0.5% 14.7 15.05sec 129119 0 Direct 14.7 104325 208974 129124 23.7% 0.0%  

Stats details: thunder_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.67 14.67 0.00 0.00 0.0000 0.0000 1894559.84 1894559.84 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.20 76.31% 104325.13 63102 117963 104007.77 0 117963 1168095 1168095 0.00
crit 3.48 23.69% 208973.81 126203 235926 193934.71 0 235926 726465 726465 0.00
 
 

Action details: thunder_bite

Static Values
  • id:198485
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198485
  • name:Thunder Bite
  • school:nature
  • tooltip:
  • description:Deals {$s1=0} Nature damage, jumping to up to $x targets.
 
Simple Action Stats Execute Interval
T20 2pc
Ascendance 2.0 185.16sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.04 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114051
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.doom_winds.up
Spelldata
  • id:114051
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a $114089r yard range. Stormstrike is empowered and has a $114089r yard range.
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, reducing the cooldown and cost of Stormstrike by {$s4=80}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$s1=30} yd range.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T20 2pc
  • harmful:false
  • if_expr:
 
Berserking 2.0 189.96sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.02 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ascendance.up|(feral_spirit.remains>5)|level<100
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Doom Winds 5.3 61.70sec

Stats details: doom_winds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.33 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: doom_winds

Static Values
  • id:204945
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:debuff.earthen_spike.up&talent.earthen_spike.enabled|!talent.earthen_spike.enabled
Spelldata
  • id:204945
  • name:Doom Winds
  • school:physical
  • tooltip:Chance to proc Windfury weapon on auto attacks increased by 100%. Windfury damage increased by {$s2=200}%.
  • description:Unleashes the inner power of the |cFFFFCC99Doomhammer|r, causing all auto attacks to trigger Windfury, and increasing damage dealt by Windfury by {$s2=200}% for {$d=6 seconds}.
 
Feral Spirit 3.0 121.14sec

Stats details: feral_spirit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 0.00 0.00 1.0193 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: feral_spirit

Static Values
  • id:51533
  • school:nature
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects$?a231723[ and grant you {$190185s1=5} Maelstrom each time they attack][].
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T20 2pc
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T20 2pc
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
pet - lightning_wolf
Crackling Surge 8.4 30.30sec

Stats details: crackling_surge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.45 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: crackling_surge

Static Values
  • id:224127
  • school:nature
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224127
  • name:Crackling Surge
  • school:nature
  • tooltip:Damage dealt increased by {$s1=50}%.
  • description:The Doom Wolf surges with electric energy, increasing all damage dealt by {$s1=50}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 6.3 0.1 48.2sec 47.0sec 27.24% 87.98% 0.1(0.1) 6.1

Buff details

  • buff initial source:T20 2pc
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:27.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114051
  • name:Ascendance
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a $114089r yard range. Stormstrike is empowered and has a $114089r yard range.
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, reducing the cooldown and cost of Stormstrike by {$s4=80}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$s1=30} yd range.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Berserking 2.0 0.0 189.8sec 189.8sec 6.80% 11.68% 0.0(0.0) 2.0

Buff details

  • buff initial source:T20 2pc
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.56% 13.56% 0.0(0.0) 1.0

Buff details

  • buff initial source:T20 2pc
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Chill of the Twisting Nether 1.1 929.6 153.5sec 0.3sec 99.27% 99.36% 929.6(929.6) 0.1

Buff details

  • buff initial source:T20 2pc
  • cooldown name:buff_chill_of_the_twisting_nether
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02

Stack Uptimes

  • chill_of_the_twisting_nether_1:99.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:207998
  • name:Chill of the Twisting Nether
  • tooltip:All damage done increased by ${{$s1=15}/10}.1%.
  • description:{$@spelldesc207994=Damaging enemies with your Fire, Frost, or Nature abilities increases all damage you deal by ${{$207995s1=15}/10}.1% for {$207995d=8 seconds}. Each element adds a separate application.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.6sec 25.1sec 32.09% 32.09% 3.1(3.1) 8.0

Buff details

  • buff initial source:T20 2pc
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Doom Winds 5.3 0.0 61.7sec 61.7sec 10.48% 18.98% 0.0(0.0) 5.2

Buff details

  • buff initial source:T20 2pc
  • cooldown name:buff_doom_winds
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • doom_winds_1:10.48%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:204945
  • name:Doom Winds
  • tooltip:Chance to proc Windfury weapon on auto attacks increased by 100%. Windfury damage increased by {$s2=200}%.
  • description:Unleashes the inner power of the |cFFFFCC99Doomhammer|r, causing all auto attacks to trigger Windfury, and increasing damage dealt by Windfury by {$s2=200}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:60.00
  • default_chance:0.00%
Fire of the Twisting Nether 1.0 1129.1 202.2sec 0.3sec 99.62% 99.70% 1129.1(1129.1) 0.0

Buff details

  • buff initial source:T20 2pc
  • cooldown name:buff_fire_of_the_twisting_nether
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02

Stack Uptimes

  • fire_of_the_twisting_nether_1:99.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:207995
  • name:Fire of the Twisting Nether
  • tooltip:All damage done increased by ${{$s1=15}/10}.1%.
  • description:{$@spelldesc207994=Damaging enemies with your Fire, Frost, or Nature abilities increases all damage you deal by ${{$207995s1=15}/10}.1% for {$207995d=8 seconds}. Each element adds a separate application.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Flametongue 6.1 13.6 50.3sec 15.6sec 97.84% 97.96% 31.5(31.5) 5.1

Buff details

  • buff initial source:T20 2pc
  • cooldown name:buff_flametongue
  • max_stacks:1
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • flametongue_1:97.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194084
  • name:Flametongue
  • tooltip:Each of your weapon attacks causes up to ${$<coeff>*$AP} additional Fire damage.
  • description:{$@spelldesc193796=Scorches your target, dealing {$s2=1} Fire damage, and enhances your weapons with fire for {$194084d=16 seconds}, causing each weapon attack to deal up to ${$<coeff>*$AP} Fire damage, based on weapon speed.}
  • max_stacks:0
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
Frostbrand 8.1 10.7 37.5sec 16.3sec 96.37% 96.71% 47.3(47.3) 7.1

Buff details

  • buff initial source:T20 2pc
  • cooldown name:buff_frostbrand
  • max_stacks:1
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • frostbrand_1:96.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196834
  • name:Frostbrand
  • tooltip:Melee attacks reduce target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
  • description:Chills your target, dealing {$s1=1} Frost damage and reducing the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}, and enhances your weapons with frost for {$d=16 seconds}, causing each weapon attack to reduce the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
  • max_stacks:0
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
Gathering Storms 19.4 1.9 15.7sec 14.2sec 22.76% 15.10% 1.9(1.9) 0.0

Buff details

  • buff initial source:T20 2pc
  • cooldown name:buff_gathering_storms
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • gathering_storms_1:22.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:198300
  • name:Gathering Storms
  • tooltip:Damage of Stormstrike increased by $w1%.
  • description:{$@spelldesc198299=Each target hit by Crash Lightning increases damage dealt by your next Stormstrike within {$198300d=12 seconds} by {$s1=2}%.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Landslide 8.7 47.6 34.4sec 5.3sec 95.67% 88.94% 47.6(47.6) 7.7

Buff details

  • buff initial source:T20 2pc
  • cooldown name:buff_landslide
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • landslide_1:95.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202004
  • name:Landslide
  • tooltip:Agility increased by {$s1=8}%.
  • description:{$@spelldesc197992=$?s201897[Boulderfist][Rockbiter] enhances your weapon, increasing your Agility by {$202004s1=8}% for {$202004d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Lightning Crash 13.0 8.4 23.5sec 14.2sec 87.58% 51.81% 8.4(8.4) 12.1

Buff details

  • buff initial source:T20 2pc
  • cooldown name:buff_lightning_crash
  • max_stacks:1
  • duration:16.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.05

Stack Uptimes

  • lightning_crash_1:87.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242284
  • name:Lightning Crash
  • tooltip:Critical strike chance increased by {$s1=5}%.
  • description:{$@spelldesc242283=Crash Lightning increases your critical strike chance by {$242284s1=5}% for {$242284d=16 seconds}.}
  • max_stacks:0
  • duration:16.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 107.6sec 0.0sec 39.98% 39.98% 0.0(0.0) 2.0

Buff details

  • buff initial source:T20 2pc
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Shock of the Twisting Nether 2.0 212.9 124.9sec 1.4sec 99.37% 99.28% 212.9(212.9) 1.0

Buff details

  • buff initial source:T20 2pc
  • cooldown name:buff_shock_of_the_twisting_nether
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02

Stack Uptimes

  • shock_of_the_twisting_nether_1:99.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:207999
  • name:Shock of the Twisting Nether
  • tooltip:All damage done increased by ${{$s1=15}/10}.1%.
  • description:{$@spelldesc207994=Damaging enemies with your Fire, Frost, or Nature abilities increases all damage you deal by ${{$207995s1=15}/10}.1% for {$207995d=8 seconds}. Each element adds a separate application.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 64.0 7.1 4.6sec 4.2sec 20.61% 49.88% 10.9(11.4) 0.0

Buff details

  • buff initial source:T20 2pc
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormbringer_1:20.61%

Trigger Attempt Success

  • trigger_pct:94.08%

Spelldata details

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike has no cooldown and its cost is reduced by {$s3=50}%.
  • description:{$@spelldesc201845=Your weapon attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike, and cause your next Stormstrike to cost {$201846s3=50}% less Maelstrom and trigger no cooldown.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Stormlash 14.1 10.5 21.7sec 12.2sec 50.17% 50.17% 10.5(10.5) 13.6

Buff details

  • buff initial source:T20 2pc
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormlash_1:50.17%

Trigger Attempt Success

  • trigger_pct:99.88%

Spelldata details

  • id:195222
  • name:Stormlash
  • tooltip:Empowered with lightning. Attacks and spellcasts have a chance to deal additional Nature damage.
  • description:{$@spelldesc195255=While your weapons are enhanced, your attacks have a chance to grant Stormlash to up to {$?s210731=false}[${$m1+$210731m1}][{$s1=2}] party or raid members for {$195222d=8 seconds}, causing attacks and spellcasts to deal additional Nature damage.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Unleash Doom 15.7 16.3 19.1sec 9.1sec 44.51% 50.69% 16.3(16.3) 15.2

Buff details

  • buff initial source:T20 2pc
  • cooldown name:buff_unleash_doom
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-0.00

Stack Uptimes

  • unleash_doom_1:44.51%

Trigger Attempt Success

  • trigger_pct:20.04%

Spelldata details

  • id:199055
  • name:Unleash Doom
  • tooltip:Your special attacks will trigger an arc of fiery or lightning damage at your target.
  • description:{$@spelldesc198736=Stormstrike has a chance to unleash the power of |cFFFFCC99Doomhammer|r, causing your special attacks to heave molten lava or lightning spikes at your target for {$199053s1=1} Fire or Nature damage.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Wind Strikes 16.4 54.7 18.6sec 4.2sec 70.98% 78.61% 55.3(59.0) 15.6

Buff details

  • buff initial source:T20 2pc
  • cooldown name:buff_wind_strikes
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.85

Stack Uptimes

  • wind_strikes_1:70.98%

Trigger Attempt Success

  • trigger_pct:94.08%

Spelldata details

  • id:198293
  • name:Wind Strikes
  • tooltip:Attack speed increased by $w1%.
  • description:{$@spelldesc198292=When Stormbringer resets the remaining cooldown on Stormstrike, you gain {$s1=3}% attack speed for {$198293d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
fiery_wolf: Alpha Wolf 1.7 0.5 96.4sec 55.2sec 73.05% 73.05% 7.7(7.7) 0.8

Buff details

  • buff initial source:T20 2pc_fiery_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:73.05%

Trigger Attempt Success

  • trigger_pct:98.84%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
fiery_wolf: Alpha Wolf 1.6 0.9 106.7sec 44.8sec 76.63% 76.63% 8.4(8.4) 0.6

Buff details

  • buff initial source:T20 2pc_fiery_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:76.63%

Trigger Attempt Success

  • trigger_pct:98.53%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
frost_wolf: Alpha Wolf 1.7 0.6 100.3sec 55.7sec 73.89% 73.89% 7.8(7.8) 0.7

Buff details

  • buff initial source:T20 2pc_frost_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:73.89%

Trigger Attempt Success

  • trigger_pct:98.60%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
frost_wolf: Alpha Wolf 1.6 0.9 110.5sec 47.0sec 75.50% 75.50% 8.1(8.1) 0.6

Buff details

  • buff initial source:T20 2pc_frost_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:75.50%

Trigger Attempt Success

  • trigger_pct:98.63%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Alpha Wolf 1.6 0.6 98.7sec 54.0sec 74.49% 74.49% 7.7(7.7) 0.7

Buff details

  • buff initial source:T20 2pc_lightning_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:74.49%

Trigger Attempt Success

  • trigger_pct:98.94%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Alpha Wolf 1.6 0.8 106.6sec 46.9sec 75.32% 75.32% 8.1(8.1) 0.6

Buff details

  • buff initial source:T20 2pc_lightning_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:75.32%

Trigger Attempt Success

  • trigger_pct:98.98%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Crackling Surge 4.1 0.0 23.3sec 23.3sec 76.10% 71.19% 0.0(0.0) 2.7

Buff details

  • buff initial source:T20 2pc_lightning_wolf
  • cooldown name:buff_crackling_surge
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • crackling_surge_1:76.10%

Trigger Attempt Success

  • trigger_pct:99.88%

Spelldata details

  • id:224127
  • name:Crackling Surge
  • tooltip:Damage dealt increased by {$s1=50}%.
  • description:The Doom Wolf surges with electric energy, increasing all damage dealt by {$s1=50}%.
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Crackling Surge 4.2 0.0 23.5sec 23.5sec 76.19% 71.15% 0.0(0.0) 2.8

Buff details

  • buff initial source:T20 2pc_lightning_wolf
  • cooldown name:buff_crackling_surge
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • crackling_surge_1:76.19%

Trigger Attempt Success

  • trigger_pct:99.89%

Spelldata details

  • id:224127
  • name:Crackling Surge
  • tooltip:Damage dealt increased by {$s1=50}%.
  • description:The Doom Wolf surges with electric energy, increasing all damage dealt by {$s1=50}%.
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:T20 2pc
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:T20 2pc
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:T20 2pc
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201639
  • name:Well Fed
  • tooltip:Agility increased by $w1.
  • description:Agility increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Strength of Will

Buff details

  • buff initial source:T20 2pc
  • cooldown name:buff_strength_of_will
  • max_stacks:10
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:304.77

Stack Uptimes

  • strength_of_will_10:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242642
  • name:Strength of Will
  • tooltip:Strength or Agility increased by {$s3=95}, based on your specialization.
  • description:{$@spelldesc242640=While you are above {$s1=80}% health you gain {$242642s3=95} Strength or Agility per second, based on your specialization, stacking up to {$242642u=10} times. If you fall below {$s2=50}% health, this effect is lost.}
  • max_stacks:10
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
Flametongue: Windfury Attack 218.0 2.8sec
Frostbrand: Windfury Attack 216.0 2.8sec
Maelstrom Weapon: Windfury Attack 221.2 2.7sec
Stormbringer: Windfury Attack 13.6 21.7sec
Stormbringer: Windfury Attack Off-Hand 2.8 75.3sec
Flametongue: main_hand 106.0 2.8sec
Frostbrand: main_hand 104.3 2.8sec
Maelstrom Weapon: main_hand 108.0 2.8sec
Stormbringer: main_hand 8.0 31.5sec
Windfury: main_hand 30.6 9.3sec
Flametongue: Windlash 52.3 5.2sec
Frostbrand: Windlash 51.1 5.3sec
Maelstrom Weapon: Windlash 54.3 5.0sec
Stormbringer: Windlash 4.0 53.9sec
Windfury: Windlash 20.4 13.0sec
Flametongue: offhand 105.6 2.8sec
Frostbrand: offhand 104.7 2.8sec
Maelstrom Weapon: offhand 107.5 2.8sec
Stormbringer: offhand 8.0 31.8sec
Windfury: offhand 8.2 25.5sec
Flametongue: Windlash Off-Hand 52.3 5.2sec
Frostbrand: Windlash Off-Hand 51.1 5.3sec
Maelstrom Weapon: Windlash Off-Hand 54.3 5.0sec
Stormbringer: Windlash Off-Hand 4.0 52.6sec
Windfury: Windlash Off-Hand 10.9 21.6sec
Flametongue: Windstrike 64.5 5.2sec
Frostbrand: Windstrike 62.9 5.3sec
Stormbringer: Windstrike 5.0 46.2sec
Windfury: Windstrike 15.1 18.5sec
Unleash Doom (damage): Windstrike 46.4 7.1sec
Flametongue: Windstrike Off-Hand 64.5 5.2sec
Frostbrand: Windstrike Off-Hand 62.9 5.3sec
Stormbringer: Windstrike Off-Hand 5.0 45.4sec
Unleash Doom (damage): Windstrike Off-Hand 46.4 7.1sec
Stormbringer: Rockbiter 4.2 53.0sec
Unleash Doom (damage): Rockbiter 23.5 12.1sec
Flametongue: Crash Lightning 21.3 14.2sec
Frostbrand: Crash Lightning 21.3 14.2sec
Stormbringer: Crash Lightning 1.6 84.0sec
Windfury: Crash Lightning 4.8 51.2sec
Unleash Doom (damage): Crash Lightning 8.5 33.5sec
Stormbringer: Flametongue 1.5 88.5sec
Unleash Doom (damage): Flametongue 8.4 33.4sec
Stormbringer: Frostbrand 1.4 88.6sec
Unleash Doom (damage): Frostbrand 7.8 35.7sec
Flametongue: Stormstrike 92.1 3.8sec
Frostbrand: Stormstrike 92.1 3.8sec
Stormbringer: Stormstrike 6.9 34.1sec
Windfury: Stormstrike 20.7 13.7sec
Unleash Doom (damage): Stormstrike 51.5 6.5sec
Flametongue: Stormstrike Off-Hand 92.1 3.8sec
Frostbrand: Stormstrike Off-Hand 92.1 3.8sec
Stormbringer: Stormstrike Off-Hand 6.8 34.1sec
Unleash Doom (damage): Stormstrike Off-Hand 51.5 6.5sec
Flametongue: Lava Lash 38.3 7.4sec
Frostbrand: Lava Lash 38.3 7.4sec
Stormbringer: Lava Lash 2.8 67.0sec
Unleash Doom (damage): Lava Lash 10.9 24.0sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Windstrike0.7760.0017.73944.0098.30697.790
Feral Spirit1.2600.00126.5242.2680.00026.524
Doom Winds1.7160.00229.4347.2340.79231.355
Ascendance5.0880.32831.3555.2730.47131.355
Rockbiter3.5860.00920.88763.39717.628130.884
Crash Lightning10.2330.00159.723202.912127.118276.991
Flametongue7.2490.00127.665134.10087.280182.098
Stormstrike1.3930.00114.261113.47737.786207.294

Resources

Resource Usage Type Count Total Average RPE APR
T20 2pc
crash_lightning Maelstrom 37.2 744.2 20.0 34.9 10580.0
frostbrand Maelstrom 32.9 657.0 20.0 34.9 57033.2
lava_lash Maelstrom 66.8 2003.7 30.0 52.3 17414.0
stormstrike Maelstrom 160.8 3734.2 23.2 50.6 19440.7
windstrike Maelstrom 118.0 592.9 5.0 11.0 124393.9
Resource Gains Type Count Total Average Overflow
Windfury Attack Maelstrom 385.87 2130.28 (27.01%) 5.52 570.84 21.13%
Main Hand Maelstrom 188.33 910.26 (11.54%) 4.83 31.39 3.33%
Windlash Maelstrom 94.78 358.48 (4.55%) 3.78 115.44 24.36%
Off-Hand Maelstrom 187.57 903.33 (11.45%) 4.82 34.51 3.68%
Windlash Off-Hand Maelstrom 94.77 354.07 (4.49%) 3.74 119.79 25.28%
Feral Spirit Maelstrom 174.82 569.40 (7.22%) 3.26 304.69 34.86%
Rockbiter Maelstrom 98.07 2660.79 (33.74%) 27.13 183.37 6.45%
Resource RPS-Gain RPS-Loss
Maelstrom 15.03 14.74
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 88.85 0.00 150.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data T20 2pc Fight Length
Count 2497
Mean 300.75
Minimum 205.56
Maximum 398.34
Spread ( max - min ) 192.77
Range [ ( max - min ) / 2 * 100% ] 32.05%
Standard Deviation 41.4215
5th Percentile 236.93
95th Percentile 369.51
( 95th Percentile - 5th Percentile ) 132.58
Mean Distribution
Standard Deviation 0.8289
95.00% Confidence Intervall ( 299.13 - 302.38 )
Normalized 95.00% Confidence Intervall ( 99.46% - 100.54% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 729
0.1% Error 72867
0.1 Scale Factor Error with Delta=300 15
0.05 Scale Factor Error with Delta=300 59
0.01 Scale Factor Error with Delta=300 1465
DPS
Sample Data T20 2pc Damage Per Second
Count 2497
Mean 1302682.77
Minimum 1104008.82
Maximum 1573584.98
Spread ( max - min ) 469576.16
Range [ ( max - min ) / 2 * 100% ] 18.02%
Standard Deviation 68135.1409
5th Percentile 1198471.01
95th Percentile 1420219.81
( 95th Percentile - 5th Percentile ) 221748.79
Mean Distribution
Standard Deviation 1363.5212
95.00% Confidence Intervall ( 1300010.32 - 1305355.22 )
Normalized 95.00% Confidence Intervall ( 99.79% - 100.21% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 106
0.1% Error 10509
0.1 Scale Factor Error with Delta=300 39630175
0.05 Scale Factor Error with Delta=300 158520699
0.01 Scale Factor Error with Delta=300 3963017460
Priority Target DPS
Sample Data T20 2pc Priority Target Damage Per Second
Count 2497
Mean 1302783.41
Minimum 1100962.52
Maximum 1551004.99
Spread ( max - min ) 450042.47
Range [ ( max - min ) / 2 * 100% ] 17.27%
Standard Deviation 66798.1625
5th Percentile 1201527.58
95th Percentile 1420231.45
( 95th Percentile - 5th Percentile ) 218703.87
Mean Distribution
Standard Deviation 1336.7655
95.00% Confidence Intervall ( 1300163.40 - 1305403.43 )
Normalized 95.00% Confidence Intervall ( 99.80% - 100.20% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 101
0.1% Error 10100
0.1 Scale Factor Error with Delta=300 38090152
0.05 Scale Factor Error with Delta=300 152360607
0.01 Scale Factor Error with Delta=300 3809015151
DPS(e)
Sample Data T20 2pc Damage Per Second (Effective)
Count 2497
Mean 1302682.77
Minimum 1104008.82
Maximum 1573584.98
Spread ( max - min ) 469576.16
Range [ ( max - min ) / 2 * 100% ] 18.02%
Damage
Sample Data T20 2pc Damage
Count 2497
Mean 377663037.60
Minimum 299675709.85
Maximum 455700636.41
Spread ( max - min ) 156024926.56
Range [ ( max - min ) / 2 * 100% ] 20.66%
DTPS
Sample Data T20 2pc Damage Taken Per Second
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data T20 2pc Healing Per Second
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data T20 2pc Healing Per Second (Effective)
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data T20 2pc Heal
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data T20 2pc Healing Taken Per Second
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data T20 2pc Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data T20 2pcTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data T20 2pc Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 potion
5 0.00 lightning_shield
Default action list Executed every time the actor is available.
# count action,conditions
0.00 wind_shear
0.00 variable,name=hailstormCheck,value=((talent.hailstorm.enabled&!buff.frostbrand.up)|!talent.hailstorm.enabled)
0.00 variable,name=furyCheck80,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>80))
0.00 variable,name=furyCheck70,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>70))
0.00 variable,name=furyCheck45,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>45))
0.00 variable,name=furyCheck25,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>25))
0.00 variable,name=OCPool70,value=(!talent.overcharge.enabled|(talent.overcharge.enabled&maelstrom>70))
0.00 variable,name=OCPool60,value=(!talent.overcharge.enabled|(talent.overcharge.enabled&maelstrom>60))
0.00 variable,name=heartEquipped,value=(equipped.151819)
0.00 variable,name=akainuEquipped,value=(equipped.137084)
0.00 variable,name=akainuAS,value=(variable.akainuEquipped&buff.hot_hand.react&!buff.frostbrand.up)
0.00 variable,name=LightningCrashNotUp,value=(!buff.lightning_crash.up&set_bonus.tier20_2pc)
0.00 variable,name=alphaWolfCheck,value=((pet.frost_wolf.buff.alpha_wolf.remains<2&pet.fiery_wolf.buff.alpha_wolf.remains<2&pet.lightning_wolf.buff.alpha_wolf.remains<2)&feral_spirit.remains>4)
6 1.00 auto_attack
7 7.17 use_items
8 0.00 call_action_list,name=opener
9 54.11 windstrike,if=(variable.heartEquipped|set_bonus.tier19_2pc)&(!talent.earthen_spike.enabled|(cooldown.earthen_spike.remains>1&cooldown.doom_winds.remains>1)|debuff.earthen_spike.up)
A 0.00 call_action_list,name=buffs
B 0.00 call_action_list,name=CDs
C 0.00 call_action_list,name=core
D 0.00 call_action_list,name=filler
actions.CDs
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
E 2.02 berserking,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
0.00 blood_fury,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
F 1.00 potion,if=buff.ascendance.up|!talent.ascendance.enabled&feral_spirit.remains>5|target.time_to_die<=60
G 2.98 feral_spirit
H 5.33 doom_winds,if=debuff.earthen_spike.up&talent.earthen_spike.enabled|!talent.earthen_spike.enabled
I 2.04 ascendance,if=buff.doom_winds.up
actions.buffs
# count action,conditions
J 7.83 rockbiter,if=talent.landslide.enabled&!buff.landslide.up
0.00 fury_of_air,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
K 2.47 crash_lightning,if=artifact.alpha_wolf.rank&prev_gcd.1.feral_spirit
L 6.10 flametongue,if=!buff.flametongue.up
M 8.12 frostbrand,if=talent.hailstorm.enabled&!buff.frostbrand.up&variable.furyCheck45
N 2.36 flametongue,if=buff.flametongue.remains<6+gcd&cooldown.doom_winds.remains<gcd*2
O 2.66 frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<6+gcd&cooldown.doom_winds.remains<gcd*2
actions.core
# count action,conditions
0.00 earthen_spike,if=variable.furyCheck25
0.00 crash_lightning,if=!buff.crash_lightning.up&active_enemies>=2
0.00 windsong
0.00 crash_lightning,if=active_enemies>=8|(active_enemies>=6&talent.crashing_storm.enabled)
0.00 windstrike
P 40.64 stormstrike,if=buff.stormbringer.up&variable.furyCheck25
0.00 crash_lightning,if=active_enemies>=4|(active_enemies>=2&talent.crashing_storm.enabled)
0.00 lightning_bolt,if=talent.overcharge.enabled&variable.furyCheck45&maelstrom>=40
Q 33.20 stormstrike,if=(!talent.overcharge.enabled&variable.furyCheck45)|(talent.overcharge.enabled&variable.furyCheck80)
0.00 frostbrand,if=variable.akainuAS
0.00 lava_lash,if=buff.hot_hand.react&((variable.akainuEquipped&buff.frostbrand.up)|!variable.akainuEquipped)
0.00 sundering,if=active_enemies>=3
R 13.95 crash_lightning,if=active_enemies>=3|variable.LightningCrashNotUp|variable.alphaWolfCheck
actions.filler
# count action,conditions
S 47.55 rockbiter,if=maelstrom<120
T 9.20 flametongue,if=buff.flametongue.remains<4.8
0.00 rockbiter,if=maelstrom<=40
0.00 crash_lightning,if=(talent.crashing_storm.enabled|active_enemies>=2)&debuff.earthen_spike.up&maelstrom>=40&variable.OCPool60
U 8.05 frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<4.8&maelstrom>40
0.00 frostbrand,if=variable.akainuEquipped&!buff.frostbrand.up&maelstrom>=75
0.00 sundering
V 38.28 lava_lash,if=maelstrom>=50&variable.OCPool70&variable.furyCheck80
0.00 rockbiter
W 4.91 crash_lightning,if=(maelstrom>=65|talent.crashing_storm.enabled|active_enemies>=2)&variable.OCPool60&variable.furyCheck45
X 1.99 flametongue
actions.opener
# count action,conditions
Y 0.83 rockbiter,if=maelstrom<15&time<2

Sample Sequence

012467YLMGKEHI99S9V9999R9T9U9V9J9VPPQSSVPQPQRSSTUSVVVPQSPQSVWS7TUVSVPWSQXPSQWSOWHXSPQVPPSQSVWXSUVPSQPWSP7QXSUPWSQPXSPWPSPQXSUWPSQXSPW9999O9FG99JNHQ7RVVPPPQJPQMSVTVRSVS9999U99999J9999999LQJM7RPQSVSP999ET9O999JHI999999999J999L9MRSQVSVPPQ7PPPLPJMQRSSVVSTVVPSPPMGKPPSQNPOHQSPPQVVRSV7SVTV9999M999JQRPPQPQLSPMQSS

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask T20 2pc 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom
Pre precombat 1 food T20 2pc 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom
Pre precombat 2 augmentation T20 2pc 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom potion_of_prolonged_power
0:00.000 default 6 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom potion_of_prolonged_power
0:00.000 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/150: 3% maelstrom potion_of_prolonged_power
0:00.000 opener Y rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/150: 3% maelstrom potion_of_prolonged_power
0:01.107 buffs L flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/150: 23% maelstrom bloodlust, landslide, concordance_of_the_legionfall, shock_of_the_twisting_nether, potion_of_prolonged_power
0:01.959 buffs M frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/150: 26% maelstrom bloodlust, flametongue, stormbringer, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, potion_of_prolonged_power
0:02.811 CDs G feral_spirit Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/150: 16% maelstrom bloodlust, flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:03.662 buffs K crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/150: 29% maelstrom bloodlust, flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:04.512 CDs E berserking Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/150: 26% maelstrom bloodlust, flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:04.512 CDs H doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/150: 26% maelstrom bloodlust, berserking, flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:04.512 CDs I ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/150: 26% maelstrom bloodlust, berserking, flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:04.512 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/150: 26% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:05.268 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/150: 55% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, wind_strikes, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:06.023 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/150: 69% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, wind_strikes, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:06.776 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, wind_strikes, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:07.530 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, unleash_doom, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:08.284 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 149.0/150: 99% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:09.040 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:09.794 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:10.548 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:11.301 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:12.056 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:12.810 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:13.565 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:14.317 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:15.070 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:15.968 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, unleash_doom, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:16.821 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom bloodlust, ascendance, flametongue, frostbrand, unleash_doom, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:17.671 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 142.0/150: 95% maelstrom bloodlust, ascendance, flametongue, frostbrand, unleash_doom, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:18.522 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, unleash_doom, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:19.376 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, unleash_doom, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:20.227 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom bloodlust, flametongue, frostbrand, stormbringer, landslide, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:21.077 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom bloodlust, flametongue, frostbrand, stormbringer, landslide, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:21.929 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:22.780 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:23.631 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/150: 66% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:24.483 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 133.0/150: 89% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:25.335 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 127.0/150: 85% maelstrom bloodlust, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:26.185 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/150: 71% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:27.035 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/150: 57% maelstrom bloodlust, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:27.888 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/150: 69% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:28.739 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/150: 43% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:29.592 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/150: 33% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:30.443 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/150: 55% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:31.294 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/150: 78% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:32.146 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 127.0/150: 85% maelstrom bloodlust, flametongue, frostbrand, landslide, wind_strikes, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:32.999 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/150: 71% maelstrom bloodlust, flametongue, frostbrand, landslide, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:33.850 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 141.0/150: 94% maelstrom bloodlust, flametongue, frostbrand, landslide, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:34.702 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/150: 77% maelstrom bloodlust, flametongue, frostbrand, landslide, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:35.553 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/150: 61% maelstrom bloodlust, flametongue, frostbrand, landslide, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:36.405 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/150: 47% maelstrom bloodlust, flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:37.257 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom bloodlust, flametongue, frostbrand, landslide, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:38.108 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom bloodlust, flametongue, frostbrand, landslide, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:38.959 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/150: 46% maelstrom bloodlust, flametongue, frostbrand, stormbringer, landslide, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:39.811 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/150: 33% maelstrom bloodlust, flametongue, frostbrand, landslide, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:40.664 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/150: 13% maelstrom bloodlust, flametongue, frostbrand, landslide, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:41.516 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/150: 45% maelstrom flametongue, frostbrand, landslide, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:42.622 filler W crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/150: 28% maelstrom flametongue, frostbrand, landslide, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:43.728 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/150: 18% maelstrom flametongue, frostbrand, landslide, wind_strikes, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:44.896 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/150: 44% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:44.896 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/150: 44% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:46.003 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/150: 47% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:47.107 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/150: 34% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:48.215 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/150: 17% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:49.321 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:50.428 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:51.535 filler W crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:52.640 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:53.744 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/150: 33% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:54.849 filler X flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/150: 19% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:55.954 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/150: 22% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:57.060 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/150: 21% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:58.168 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/150: 44% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
0:59.274 filler W crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/150: 24% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:00.379 Waiting     0.800 sec 220000.0/220000: 100% mana | 21.0/150: 14% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:01.179 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/150: 14% maelstrom flametongue, frostbrand, landslide, unleash_doom, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:02.523 buffs O frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, landslide, unleash_doom, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:03.631 filler W crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, frostbrand, landslide, unleash_doom, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:04.784 CDs H doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:04.784 filler X flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, frostbrand, landslide, doom_winds, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:05.889 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/150: 29% maelstrom flametongue, frostbrand, landslide, doom_winds, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:06.996 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/150: 61% maelstrom flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:08.102 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/150: 61% maelstrom flametongue, frostbrand, landslide, doom_winds, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:09.209 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, landslide, doom_winds, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:10.314 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:11.418 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/150: 26% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:12.524 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/150: 25% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:13.630 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/150: 48% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:14.735 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/150: 28% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:15.842 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/150: 47% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:16.948 filler W crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/150: 31% maelstrom flametongue, frostbrand, landslide, unleash_doom, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:18.051 filler X flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/150: 21% maelstrom flametongue, frostbrand, landslide, unleash_doom, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:19.155 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, landslide, unleash_doom, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:20.260 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/150: 59% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:21.364 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/150: 46% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:22.469 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/150: 29% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:23.576 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/150: 19% maelstrom flametongue, frostbrand, landslide, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:24.681 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/150: 42% maelstrom flametongue, frostbrand, landslide, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:25.786 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/150: 19% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:26.891 filler W crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/150: 21% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:27.997 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/150: 8% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:29.102 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/150: 31% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:30.208 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:30.208 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:31.314 filler X flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:32.421 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:33.527 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/150: 36% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:34.633 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/150: 26% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:35.739 filler W crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/150: 19% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:36.845 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/150: 19% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:37.950 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/150: 38% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:39.054 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/150: 15% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:40.160 filler X flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/150: 5% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:41.266 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/150: 8% maelstrom flametongue, frostbrand, landslide, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:42.370 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/150: 34% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:43.476 filler W crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/150: 24% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:44.582 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/150: 17% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:45.688 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/150: 7% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:46.793 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:47.898 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/150: 29% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:49.003 filler X flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/150: 6% maelstrom flametongue, frostbrand, landslide, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:50.107 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/150: 9% maelstrom flametongue, frostbrand, landslide, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:51.212 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/150: 32% maelstrom flametongue, frostbrand, landslide, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:52.318 filler W crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/150: 22% maelstrom flametongue, frostbrand, landslide, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:53.422 Waiting     0.300 sec 220000.0/220000: 100% mana | 18.0/150: 12% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:53.722 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/150: 15% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:54.828 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/150: 5% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:55.935 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/150: 28% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:57.040 Waiting     0.600 sec 220000.0/220000: 100% mana | 7.0/150: 5% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:57.640 filler X flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/150: 5% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:58.921 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/150: 8% maelstrom flametongue, frostbrand, landslide, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:00.025 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/150: 31% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:01.130 filler W crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/150: 24% maelstrom flametongue, frostbrand, landslide, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:02.235 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/150: 14% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:03.340 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/150: 24% maelstrom ascendance, flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:04.444 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/150: 44% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:05.549 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/150: 54% maelstrom ascendance, flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:06.656 buffs O frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/150: 52% maelstrom ascendance, flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:07.762 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/150: 45% maelstrom ascendance, flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:08.867 CDs F potion Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom ascendance, flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:08.867 CDs G feral_spirit Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom ascendance, flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:09.971 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom ascendance, flametongue, frostbrand, lightning_crash, fire_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:11.078 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/150: 61% maelstrom ascendance, flametongue, frostbrand, stormbringer, wind_strikes, lightning_crash, fire_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:12.183 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/150: 69% maelstrom flametongue, frostbrand, wind_strikes, lightning_crash, fire_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:13.289 buffs N flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:14.394 CDs H doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:14.394 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, doom_winds, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:15.499 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:15.499 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:16.606 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, doom_winds, unleash_doom, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:17.713 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 149.0/150: 99% maelstrom flametongue, frostbrand, landslide, doom_winds, unleash_doom, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:18.819 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 148.0/150: 99% maelstrom flametongue, frostbrand, stormbringer, landslide, doom_winds, unleash_doom, wind_strikes, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:19.923 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer, landslide, doom_winds, unleash_doom, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:21.029 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:22.134 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:23.239 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 139.0/150: 93% maelstrom flametongue, frostbrand, stormbringer, wind_strikes, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:24.345 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:25.449 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 149.0/150: 99% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:26.553 buffs M frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 128.0/150: 85% maelstrom ascendance, flametongue, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:27.658 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/150: 79% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:28.762 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:29.867 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:30.973 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:32.077 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom ascendance, flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:33.182 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom ascendance, flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:34.286 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 129.0/150: 86% maelstrom ascendance, flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:35.391 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/150: 69% maelstrom ascendance, flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:36.496 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:37.602 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:38.707 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:39.812 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:40.918 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:42.024 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:43.127 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:44.235 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:45.342 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:46.448 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, unleash_doom, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:47.554 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 147.0/150: 98% maelstrom ascendance, flametongue, frostbrand, unleash_doom, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:48.660 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:49.764 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:50.869 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:51.974 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 147.0/150: 98% maelstrom ascendance, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:53.080 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:54.187 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:55.290 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:56.395 buffs L flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 146.0/150: 97% maelstrom frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:57.501 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:58.607 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom flametongue, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:59.713 buffs M frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 149.0/150: 99% maelstrom flametongue, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:00.818 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 134.0/150: 89% maelstrom flametongue, frostbrand, landslide, unleash_doom, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:00.818 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 134.0/150: 89% maelstrom flametongue, frostbrand, landslide, unleash_doom, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:01.925 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 133.0/150: 89% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:03.030 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/150: 79% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:04.135 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/150: 55% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:05.240 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/150: 81% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:06.346 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/150: 65% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:07.454 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 145.0/150: 97% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:08.558 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
3:09.662 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 132.0/150: 88% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:10.768 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 138.0/150: 92% maelstrom ascendance, flametongue, frostbrand, landslide, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:11.873 CDs E berserking Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:11.873 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:12.834 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:13.796 buffs O frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 142.0/150: 95% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:14.758 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 127.0/150: 85% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, unleash_doom, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:15.719 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/150: 83% maelstrom berserking, ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:16.680 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 144.0/150: 96% maelstrom berserking, ascendance, flametongue, frostbrand, stormbringer, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:17.642 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 145.0/150: 97% maelstrom berserking, flametongue, frostbrand, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:18.603 CDs H doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom berserking, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:18.603 CDs I ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom berserking, flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:18.603 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:19.566 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom berserking, ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:20.529 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:21.491 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom berserking, ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:22.452 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:23.559 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:24.665 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:25.769 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 147.0/150: 98% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:26.874 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 148.0/150: 99% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:27.980 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:29.084 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:30.191 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:31.296 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:32.400 buffs L flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 147.0/150: 98% maelstrom ascendance, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:33.505 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:34.611 buffs M frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 147.0/150: 98% maelstrom flametongue, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:35.716 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 132.0/150: 88% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:36.821 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/150: 78% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:37.927 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:39.032 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, landslide, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:40.138 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, landslide, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:41.244 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/150: 83% maelstrom flametongue, frostbrand, landslide, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:42.349 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/150: 66% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:43.455 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/150: 59% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:44.561 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/150: 59% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:45.668 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/150: 51% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:45.668 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/150: 51% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:46.774 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/150: 44% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:47.879 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/150: 31% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:48.985 buffs L flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:50.089 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/150: 39% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:51.195 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/150: 29% maelstrom flametongue, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:52.300 buffs M frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/150: 55% maelstrom flametongue, landslide, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:53.405 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/150: 45% maelstrom flametongue, frostbrand, landslide, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:54.513 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/150: 22% maelstrom flametongue, frostbrand, landslide, unleash_doom, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:55.619 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/150: 12% maelstrom flametongue, frostbrand, landslide, unleash_doom, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:56.724 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/150: 38% maelstrom flametongue, frostbrand, landslide, unleash_doom, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:57.830 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/150: 61% maelstrom flametongue, frostbrand, landslide, unleash_doom, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:58.936 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/150: 44% maelstrom flametongue, frostbrand, landslide, unleash_doom, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:00.041 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/150: 27% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:01.146 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:02.252 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:03.358 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:04.463 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:05.569 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:06.675 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/150: 36% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:07.780 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/150: 26% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:08.885 buffs M frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/150: 16% maelstrom flametongue, landslide, unleash_doom, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:09.988 CDs G feral_spirit Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/150: 9% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:11.094 buffs K crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/150: 19% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:12.199 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/150: 16% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:13.304 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/150: 16% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:14.409 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/150: 13% maelstrom flametongue, frostbrand, landslide, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:15.514 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/150: 51% maelstrom flametongue, frostbrand, landslide, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:16.619 buffs N flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/150: 41% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:17.724 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/150: 61% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:18.830 buffs O frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/150: 61% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:19.935 CDs H doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/150: 57% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:19.935 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/150: 57% maelstrom flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:21.041 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/150: 37% maelstrom flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:22.149 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/150: 83% maelstrom flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:23.254 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 147.0/150: 98% maelstrom flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:24.359 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, doom_winds, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:25.465 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, doom_winds, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:26.572 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:27.678 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:28.782 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, landslide, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:29.885 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/150: 83% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:30.991 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/150: 75% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:30.991 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/150: 75% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:32.094 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 147.0/150: 98% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:33.200 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 127.0/150: 85% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:34.304 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 132.0/150: 88% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:35.410 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/150: 71% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:36.516 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/150: 72% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:37.621 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 142.0/150: 95% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:38.727 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 143.0/150: 95% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:39.831 buffs M frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:40.937 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:42.042 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 137.0/150: 91% maelstrom ascendance, flametongue, frostbrand, stormbringer, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:43.149 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:44.254 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 147.0/150: 98% maelstrom ascendance, flametongue, frostbrand, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:45.358 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:46.464 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:47.569 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/150: 76% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:48.675 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/150: 66% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:49.780 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/150: 56% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:50.886 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/150: 42% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:51.991 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/150: 32% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:53.097 buffs L flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/150: 12% maelstrom frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:54.202 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/150: 12% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:55.307 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/150: 38% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:56.414 buffs M frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/150: 28% maelstrom flametongue, landslide, wind_strikes, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:57.520 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/150: 27% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:58.626 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 6.0/150: 4% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:59.732 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, landslide, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4728 4403 0
Agility 44332 38901 28018 (24626)
Stamina 81377 81377 45295
Intellect 7649 7324 0
Spirit 1 1 0
Health 4882620 4882620 0
Mana 220000 220000 0
Maelstrom 150 150 0
Spell Power 53198 46681 0
Crit 18.60% 18.60% 3439
Haste 36.17% 36.17% 13565
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 44332 38901 0
Mastery 60.58% 60.58% 8916
Armor 3282 3282 3282
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 939.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of the Skybreaker
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +871 Crit, +515 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Flesh-Raking Leggings
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Mastery }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }, gems: { +150 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Eye of the Twisting Nether
ilevel: 970, stats: { +3515 Sta, +2884 Haste, +1602 Mastery }, gems: { +200 Agi }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Specter of Betrayal
ilevel: 940, stats: { +2994 StrAgi }
Local Trinket2 Cradle of Anguish
ilevel: 930, stats: { +1320 Haste }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Agi }
Local Main Hand Doomhammer
ilevel: 951, weapon: { 8445 - 15685, 2.6 }, stats: { +1496 Agi, +2244 Sta, +435 Crit, +418 Mastery }, relics: { +67 ilevels, +67 ilevels, +67 ilevels }
Local Off Hand Fury of the Stonemother
ilevel: 951, weapon: { 8445 - 15685, 2.6 }, stats: { +1496 Agi, +2244 Sta, +435 Crit, +418 Mastery }

Talents

Level
15 Windsong (Enhancement Shaman) Hot Hand (Enhancement Shaman) Landslide (Enhancement Shaman)
30 Rainfall (Enhancement Shaman) Feral Lunge (Enhancement Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Lightning Shield (Enhancement Shaman) Ancestral Swiftness Hailstorm (Enhancement Shaman)
75 Tempest (Enhancement Shaman) Overcharge (Enhancement Shaman) Empowered Stormlash (Enhancement Shaman)
90 Crashing Storm (Enhancement Shaman) Fury of Air (Enhancement Shaman) Sundering (Enhancement Shaman)
100 Ascendance (Enhancement Shaman) Boulderfist (Enhancement Shaman) Earthen Spike (Enhancement Shaman)

Profile

shaman="T20 2pc"
spec=enhancement
level=110
race=troll
role=attack
position=back
talents=3133111
artifact=41:0:0:0:0:899:1:900:1:901:1:902:1:903:1:904:1:905:4:906:4:907:4:908:4:909:4:910:4:911:4:912:4:913:4:930:1:1351:1:1388:1:1593:4:1594:1:1595:1:1596:1:1687:1

# Default consumables
potion=prolonged_power
flask=seventh_demon
food=lavish_suramar_feast
augmentation=defiled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/lightning_shield

# Executed every time the actor is available.
actions=wind_shear
actions+=/variable,name=hailstormCheck,value=((talent.hailstorm.enabled&!buff.frostbrand.up)|!talent.hailstorm.enabled)
actions+=/variable,name=furyCheck80,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>80))
actions+=/variable,name=furyCheck70,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>70))
actions+=/variable,name=furyCheck45,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>45))
actions+=/variable,name=furyCheck25,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>25))
actions+=/variable,name=OCPool70,value=(!talent.overcharge.enabled|(talent.overcharge.enabled&maelstrom>70))
actions+=/variable,name=OCPool60,value=(!talent.overcharge.enabled|(talent.overcharge.enabled&maelstrom>60))
actions+=/variable,name=heartEquipped,value=(equipped.151819)
actions+=/variable,name=akainuEquipped,value=(equipped.137084)
actions+=/variable,name=akainuAS,value=(variable.akainuEquipped&buff.hot_hand.react&!buff.frostbrand.up)
actions+=/variable,name=LightningCrashNotUp,value=(!buff.lightning_crash.up&set_bonus.tier20_2pc)
actions+=/variable,name=alphaWolfCheck,value=((pet.frost_wolf.buff.alpha_wolf.remains<2&pet.fiery_wolf.buff.alpha_wolf.remains<2&pet.lightning_wolf.buff.alpha_wolf.remains<2)&feral_spirit.remains>4)
actions+=/auto_attack
actions+=/use_items
actions+=/call_action_list,name=opener
actions+=/windstrike,if=(variable.heartEquipped|set_bonus.tier19_2pc)&(!talent.earthen_spike.enabled|(cooldown.earthen_spike.remains>1&cooldown.doom_winds.remains>1)|debuff.earthen_spike.up)
actions+=/call_action_list,name=buffs
actions+=/call_action_list,name=CDs
actions+=/call_action_list,name=core
actions+=/call_action_list,name=filler

actions.CDs=bloodlust,if=target.health.pct<25|time>0.500
actions.CDs+=/berserking,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
actions.CDs+=/blood_fury,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
actions.CDs+=/potion,if=buff.ascendance.up|!talent.ascendance.enabled&feral_spirit.remains>5|target.time_to_die<=60
actions.CDs+=/feral_spirit
actions.CDs+=/doom_winds,if=debuff.earthen_spike.up&talent.earthen_spike.enabled|!talent.earthen_spike.enabled
actions.CDs+=/ascendance,if=buff.doom_winds.up

actions.buffs=rockbiter,if=talent.landslide.enabled&!buff.landslide.up
actions.buffs+=/fury_of_air,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
actions.buffs+=/crash_lightning,if=artifact.alpha_wolf.rank&prev_gcd.1.feral_spirit
actions.buffs+=/flametongue,if=!buff.flametongue.up
actions.buffs+=/frostbrand,if=talent.hailstorm.enabled&!buff.frostbrand.up&variable.furyCheck45
actions.buffs+=/flametongue,if=buff.flametongue.remains<6+gcd&cooldown.doom_winds.remains<gcd*2
actions.buffs+=/frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<6+gcd&cooldown.doom_winds.remains<gcd*2

actions.core=earthen_spike,if=variable.furyCheck25
actions.core+=/crash_lightning,if=!buff.crash_lightning.up&active_enemies>=2
actions.core+=/windsong
actions.core+=/crash_lightning,if=active_enemies>=8|(active_enemies>=6&talent.crashing_storm.enabled)
actions.core+=/windstrike
actions.core+=/stormstrike,if=buff.stormbringer.up&variable.furyCheck25
actions.core+=/crash_lightning,if=active_enemies>=4|(active_enemies>=2&talent.crashing_storm.enabled)
actions.core+=/lightning_bolt,if=talent.overcharge.enabled&variable.furyCheck45&maelstrom>=40
actions.core+=/stormstrike,if=(!talent.overcharge.enabled&variable.furyCheck45)|(talent.overcharge.enabled&variable.furyCheck80)
actions.core+=/frostbrand,if=variable.akainuAS
actions.core+=/lava_lash,if=buff.hot_hand.react&((variable.akainuEquipped&buff.frostbrand.up)|!variable.akainuEquipped)
actions.core+=/sundering,if=active_enemies>=3
actions.core+=/crash_lightning,if=active_enemies>=3|variable.LightningCrashNotUp|variable.alphaWolfCheck

actions.filler=rockbiter,if=maelstrom<120
actions.filler+=/flametongue,if=buff.flametongue.remains<4.8
actions.filler+=/rockbiter,if=maelstrom<=40
actions.filler+=/crash_lightning,if=(talent.crashing_storm.enabled|active_enemies>=2)&debuff.earthen_spike.up&maelstrom>=40&variable.OCPool60
actions.filler+=/frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<4.8&maelstrom>40
actions.filler+=/frostbrand,if=variable.akainuEquipped&!buff.frostbrand.up&maelstrom>=75
actions.filler+=/sundering
actions.filler+=/lava_lash,if=maelstrom>=50&variable.OCPool70&variable.furyCheck80
actions.filler+=/rockbiter
actions.filler+=/crash_lightning,if=(maelstrom>=65|talent.crashing_storm.enabled|active_enemies>=2)&variable.OCPool60&variable.furyCheck45
actions.filler+=/flametongue

actions.opener=rockbiter,if=maelstrom<15&time<2

head=helmet_of_the_skybreaker,id=147178,bonus_id=1512/3563
neck=string_of_extracted_incisors,id=147013,bonus_id=1512/3563,enchant_id=5439
shoulders=pauldrons_of_the_skybreaker,id=147180,bonus_id=1512/3563
back=drape_of_the_skybreaker,id=147176,bonus_id=1512/3563,enchant_id=5435
chest=harness_of_the_skybreaker,id=147175,bonus_id=1512/3563
wrists=painsinged_armguards,id=147057,bonus_id=1512/3563
hands=smoldering_heart,id=151819,bonus_id=3570
waist=waistguard_of_interminable_unity,id=147056,bonus_id=1512/3563
legs=fleshraking_leggings,id=147051,bonus_id=1512/3563
feet=starstalker_treads,id=147046,bonus_id=1522/3563,gem_id=130222
finger1=eye_of_the_twisting_nether,id=137050,bonus_id=3570,gem_id=130247,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,bonus_id=1512/3563,enchant=200haste
trinket1=specter_of_betrayal,id=151190,bonus_id=1522/3563
trinket2=cradle_of_anguish,id=147010,bonus_id=1512/3563
main_hand=doomhammer,id=128819,bonus_id=745,gem_id=147088/147100/147115,relic_id=1512:3563/1512:3563/1512:3563
off_hand=fury_of_the_stonemother,id=128873,gem_id=0/0/0/0,relic_id=0/0

# Gear Summary
# gear_ilvl=938.88
# gear_agility=28018
# gear_stamina=45295
# gear_crit_rating=3439
# gear_haste_rating=13565
# gear_mastery_rating=8916
# gear_versatility_rating=2624
# gear_armor=3282
# set_bonus=tier20_2pc=1

T20 4pc : 1342481 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1342480.7 1342480.7 2839.2 / 0.211% 279805.4 / 20.8% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.41% 60.6 100.1% 100%
Talents
  • 15: Landslide (Enhancement Shaman)
  • 30: Rainfall (Enhancement Shaman)
  • 45: Voodoo Totem
  • 60: Hailstorm (Enhancement Shaman)
  • 75: Tempest (Enhancement Shaman)
  • 90: Crashing Storm (Enhancement Shaman)
  • 100: Ascendance (Enhancement Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
T20 4pc 1342481
Crash Lightning 54262 (64241) 4.1% (4.8%) 21.3 14.26sec 906027 854892 Direct 21.3 644328 1226654 764733 20.7% 0.0%  

Stats details: crash_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.28 21.28 0.00 0.00 1.0598 0.0000 16269896.85 16269896.85 0.00 854892.17 854892.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.88 79.32% 644327.80 181928 1265058 655954.61 378221 999086 10874550 10874550 0.00
crit 4.40 20.68% 1226653.76 363856 2530117 1239503.29 0 2530117 5395347 5395347 0.00
 
 

Action details: crash_lightning

Static Values
  • id:187874
  • school:nature
  • resource:maelstrom
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:artifact.alpha_wolf.rank&prev_gcd.1.feral_spirit
Spelldata
  • id:187874
  • name:Crash Lightning
  • school:nature
  • tooltip:Stormstrike and Lava Lash deal an additional $195592sw1 damage to all targets in front of you.
  • description:Electrocutes all enemies in front of you, dealing $sw1 Nature damage. Hitting 2 or more targets enhances your weapons for {$187878d=10 seconds}, causing Stormstrike and Lava Lash to also deal $195592sw1 Nature damage to all targets in front of you.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.50
 
    Crashing Storm 9979 0.7% 147.3 2.00sec 20415 0 Direct 147.3 16496 32989 20415 23.8% 0.0%  

Stats details: crashing_storm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 147.34 147.34 0.00 0.00 0.0000 0.0000 3007921.65 3007921.65 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 112.33 76.24% 16496.29 14519 18094 16504.99 16023 17185 1853022 1853022 0.00
crit 35.01 23.76% 32989.50 29037 36187 33005.38 31857 34586 1154900 1154900 0.00
 
 

Action details: crashing_storm

Static Values
  • id:210801
  • school:nature
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210801
  • name:Crashing Storm
  • school:nature
  • tooltip:
  • description:{$@spelldesc192246=Crash Lightning also electrifies the ground, leaving an electrical field behind which damages enemies within it for ${7*{$210801s1=1}} Nature damage over {$210797d=6 seconds}. }
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.160000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Dread Torrent 40688 3.0% 53.0 10.60sec 230618 0 Direct 53.0 187683 375469 230608 22.9% 0.0%  

Stats details: dread_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.04 53.04 0.00 0.00 0.0000 0.0000 12230989.76 12230989.76 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.91 77.14% 187683.12 182405 187918 187678.08 186960 187918 7678036 7678036 0.00
crit 12.13 22.86% 375469.16 364809 375836 375456.77 372160 375836 4552954 4552954 0.00
 
 

Action details: dread_torrent

Static Values
  • id:246464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246464
  • name:Dread Torrent
  • school:shadow
  • tooltip:
  • description:{$@spelldesc246461=Create a Dread Reflection at your location for {$d=60 seconds} and cause each of your Dread Reflections to unleash a torrent of magic that deals ${{$246464s1=39731 to 43913}*4} Shadow damage over {$246463d=3 seconds}, split evenly among nearby enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:140074.50
  • base_dd_max:154819.18
 
Flametongue 15467 (68383) 1.2% (5.1%) 19.6 15.62sec 1043412 983771 Direct 19.6 192322 384585 236789 23.1% 0.0%  

Stats details: flametongue

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.63 19.63 0.00 0.00 1.0606 0.0000 4649576.09 4649576.09 0.00 983771.12 983771.12
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.09 76.86% 192321.52 177339 210826 192410.57 186017 200098 2902406 2902406 0.00
crit 4.54 23.14% 384585.43 359999 421651 381849.68 0 421651 1747170 1747170 0.00
 
 

Action details: flametongue

Static Values
  • id:193796
  • school:fire
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!buff.flametongue.up
Spelldata
  • id:193796
  • name:Flametongue
  • school:fire
  • tooltip:
  • description:Scorches your target, dealing {$s2=1} Fire damage, and enhances your weapons with fire for {$194084d=16 seconds}, causing each weapon attack to deal up to ${$<coeff>*$AP} Fire damage, based on weapon speed.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Flametongue Attack 52916 3.9% 907.6 0.60sec 17450 0 Direct 907.6 14187 28378 17450 23.0% 0.0%  

Stats details: flametongue_attack

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 907.62 907.62 0.00 0.00 0.0000 0.0000 15837457.38 15837457.38 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 698.98 77.01% 14187.43 12111 15550 14192.70 13877 14612 9916658 9916658 0.00
crit 208.64 22.99% 28378.04 24223 31099 28388.34 27750 29292 5920799 5920799 0.00
 
 

Action details: flametongue_attack

Static Values
  • id:10444
  • school:fire
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:{$@spelldesc193796=Scorches your target, dealing {$s2=1} Fire damage, and enhances your weapons with fire for {$194084d=16 seconds}, causing each weapon attack to deal up to ${$<coeff>*$AP} Fire damage, based on weapon speed.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Frostbrand 9159 (125059) 0.7% (9.3%) 18.8 16.29sec 1990356 1875934 Direct 18.8 118733 237407 146220 23.2% 0.0%  

Stats details: frostbrand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.82 18.82 87.24 0.00 1.0610 3.3008 2751635.64 2751635.64 0.00 121644.88 1875933.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.46 76.84% 118733.44 109360 130010 118788.41 114593 124780 1716996 1716996 0.00
crit 4.36 23.16% 237407.04 222001 260020 235602.93 0 260020 1034639 1034639 0.00
 
 

Action details: frostbrand

Static Values
  • id:196834
  • school:frost
  • resource:maelstrom
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.hailstorm.enabled&!buff.frostbrand.up&variable.furyCheck45
Spelldata
  • id:196834
  • name:Frostbrand
  • school:frost
  • tooltip:Melee attacks reduce target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
  • description:Chills your target, dealing {$s1=1} Frost damage and reducing the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}, and enhances your weapons with frost for {$d=16 seconds}, causing each weapon attack to reduce the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.925000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.00
  • base_tick_time:5.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Hailstorm 115900 8.6% 895.8 0.60sec 38741 0 Direct 895.8 31501 63009 38741 23.0% 0.0%  

Stats details: hailstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 895.82 895.82 0.00 0.00 0.0000 0.0000 34705134.35 34705134.35 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 689.97 77.02% 31501.30 28255 33735 31510.15 30979 32242 21734937 21734937 0.00
crit 205.85 22.98% 63009.03 56510 67470 63027.48 61859 64422 12970198 12970198 0.00
 
 

Action details: hailstorm

Static Values
  • id:210854
  • school:frost
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210854
  • name:Hailstorm
  • school:frost
  • tooltip:
  • description:{$@spelldesc210853=Frostbrand now also enhances your weapon's damage, causing each of your weapon attacks to also deal $210854sw1 Frost damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.30
 
Lava Lash 104351 (115968) 7.8% (8.7%) 38.3 7.44sec 910940 859218 Direct 38.3 663682 1323101 819651 23.7% 0.0%  

Stats details: lava_lash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.34 38.34 0.00 0.00 1.0602 0.0000 31421501.05 31421501.05 0.00 859217.52 859217.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.27 76.35% 663682.34 454911 1478679 671701.14 521574 983320 19425398 19425398 0.00
crit 9.07 23.65% 1323101.38 909823 2957357 1338154.35 909823 2773205 11996103 11996103 0.00
 
 

Action details: lava_lash

Static Values
  • id:60103
  • school:fire
  • resource:maelstrom
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.hot_hand.react&((variable.akainuEquipped&buff.frostbrand.up)|!variable.akainuEquipped)
Spelldata
  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing $sw1 Fire damage.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:7.81
 
    Doom Vortex (_ll) 11617 0.9% 45.9 5.71sec 76187 0 Direct 45.9 61877 123728 76188 23.1% 0.0%  

Stats details: doom_vortex_ll

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.94 45.94 0.00 0.00 0.0000 0.0000 3499676.60 3499676.60 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.31 76.86% 61877.14 53634 67845 61911.58 58250 66498 2184738 2184738 0.00
crit 10.63 23.14% 123727.80 107269 135691 123691.71 0 135691 1314939 1314939 0.00
 
 

Action details: doom_vortex_ll

Static Values
  • id:199116
  • school:fire
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:199116
  • name:Doom Vortex
  • school:fire
  • tooltip:
  • description:{$@spelldesc199107=Lava Lash{$?s210727=false}[ and Lightning Bolt have][ has] a chance to cause |cFFFFCC99Doomhammer|r to release a fiery tornado at your target's location, dealing ${3*{$199116s1=1}} Fire damage over {$199121d=3 seconds} to enemies within $199116A1 yards.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.600000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
main_hand 19614 1.5% 133.0 2.27sec 44479 28214 Direct 133.0 42792 85593 44480 23.0% 19.0%  

Stats details: main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 132.97 132.97 0.00 0.00 1.5765 0.0000 5914565.98 8694972.24 31.98 28214.18 28214.18
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.13 58.00% 42792.05 38433 46041 42805.82 41815 44083 3300368 4851854 31.98
crit 30.54 22.97% 85592.71 75731 92082 85617.71 82911 89810 2614198 3843118 31.98
miss 25.31 19.03% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Mark of the Hidden Satyr 21605 1.6% 20.5 14.68sec 316207 0 Direct 20.5 257310 515135 316176 22.8% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.50 20.50 0.00 0.00 0.0000 0.0000 6482309.45 6482309.45 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.82 77.16% 257309.73 223468 282681 257376.28 244572 273549 4069907 4069907 0.00
crit 4.68 22.84% 515134.71 446936 565361 509283.16 0 565361 2412402 2412402 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
offhand 9777 0.7% 132.4 2.27sec 22265 14071 Direct 132.4 21413 42818 22267 22.9% 18.9%  

Stats details: offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 132.44 132.44 0.00 0.00 1.5824 0.0000 2948829.50 4335058.68 31.98 14070.66 14070.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.99 58.13% 21412.50 19217 23021 21420.42 20943 22059 1648472 2423410 31.98
crit 30.37 22.93% 42817.90 38433 46041 42832.69 41562 44504 1300358 1911649 31.98
miss 25.08 18.94% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: offhand

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Rockbiter 101119 7.6% 56.0 5.32sec 543629 508046 Direct 56.0 440446 881185 543632 23.4% 0.0%  

Stats details: rockbiter

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.05 56.05 0.00 0.00 1.0700 0.0000 30469569.41 30469569.41 0.00 508046.31 508046.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.93 76.59% 440445.53 406397 483136 440652.14 427083 454937 18906698 18906698 0.00
crit 13.12 23.41% 881185.46 824986 966273 881617.36 837361 940774 11562872 11562872 0.00
 
 

Action details: rockbiter

Static Values
  • id:193786
  • school:nature
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.landslide.enabled&!buff.landslide.up
Spelldata
  • id:193786
  • name:Rockbiter
  • school:nature
  • tooltip:
  • description:Assaults your target with earthen power, dealing {$s1=0} Nature damage. |cFFFFFFFFGenerates {$s2=25} Maelstrom.|r
 
Stormlash 39457 2.9% 698.9 1.08sec 16941 0 Direct 698.9 16941 0 16941 0.0% 0.0%  

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 698.86 698.86 0.00 0.00 0.0000 0.0000 11839453.03 11839453.03 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 698.86 100.00% 16940.79 2703 105768 16937.84 14807 19436 11839453 11839453 0.00
 
 

Action details: stormlash

Static Values
  • id:213307
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:213307
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:{$@spelldesc195255=While your weapons are enhanced, your attacks have a chance to grant Stormlash to up to {$?s210731=false}[${$m1+$210731m1}][{$s1=2}] party or raid members for {$195222d=8 seconds}, causing attacks and spellcasts to deal additional Nature damage.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:2.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:19831.69
  • base_dd_max:19831.69
 
Stormstrike 0 (240976) 0.0% (18.0%) 73.7 3.77sec 983194 911326

Stats details: stormstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.75 0.00 0.00 0.00 1.0789 0.0000 0.00 0.00 0.00 911326.08 911326.08
 
 

Action details: stormstrike

Static Values
  • id:17364
  • school:physical
  • resource:maelstrom
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.stormbringer.up&variable.furyCheck25
Spelldata
  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of ${$32175sw1+$32176sw1} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
    Stormstrike (_mh) 160652 12.0% 92.1 3.77sec 524557 0 Direct 92.1 332641 807599 524564 40.4% 0.0%  

Stats details: stormstrike_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.14 92.14 0.00 0.00 0.0000 0.0000 48334180.55 71055823.75 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 54.91 59.60% 332640.98 136669 520883 333296.06 278450 391292 18266288 26853174 31.98
crit 37.23 40.40% 807598.86 273338 1041766 808970.27 694744 900143 30067892 44202649 31.98
 
 

Action details: stormstrike_mh

Static Values
  • id:32175
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of ${$32175sw1+$32176sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:7.50
 
    Stormstrike Off-Hand 80323 6.0% 92.1 3.77sec 262340 0 Direct 92.1 166468 403225 262329 40.5% 0.0%  

Stats details: stormstrike_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.14 92.14 0.00 0.00 0.0000 0.0000 24172745.04 35536224.91 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 54.83 59.51% 166467.75 68334 260441 166819.63 139637 198978 9127489 13418274 31.98
crit 37.31 40.49% 403224.75 136669 520883 403796.11 322625 457186 15045256 22117951 31.98
 
 

Action details: stormstrike_offhand

Static Values
  • id:32176
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of ${$32175sw1+$32176sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:7.50
 
Unleash Lava 47000 3.5% 127.0 3.18sec 110337 0 Direct 125.5 90859 181794 111670 22.9% 0.0%  

Stats details: unleash_lava

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 126.97 125.45 0.00 0.00 0.0000 0.0000 14009803.16 14009803.16 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 96.74 77.11% 90859.13 78663 99506 90893.64 87808 94588 8789583 8789583 0.00
crit 28.71 22.89% 181793.87 157326 199012 181855.33 173746 191620 5220220 5220220 0.00
 
 

Action details: unleash_lava

Static Values
  • id:199053
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:1.2000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:199053
  • name:Unleash Lava
  • school:fire
  • tooltip:
  • description:{$@spelldesc198736=Stormstrike has a chance to unleash the power of |cFFFFCC99Doomhammer|r, causing your special attacks to heave molten lava or lightning spikes at your target for {$199053s1=1} Fire or Nature damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.800000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Unleash Lightning 47017 3.5% 127.0 3.18sec 110311 0 Direct 125.5 90864 181793 111660 22.9% 0.0%  

Stats details: unleash_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 127.05 125.51 0.00 0.00 0.0000 0.0000 14014817.69 14014817.69 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 96.81 77.13% 90864.04 77500 99506 90897.66 86575 94598 8796570 8796570 0.00
crit 28.70 22.87% 181792.62 157326 199012 181856.52 173121 192765 5218248 5218248 0.00
 
 

Action details: unleash_lightning

Static Values
  • id:199054
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:1.2000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:199054
  • name:Unleash Lightning
  • school:nature
  • tooltip:
  • description:{$@spelldesc198736=Stormstrike has a chance to unleash the power of |cFFFFCC99Doomhammer|r, causing your special attacks to heave molten lava or lightning spikes at your target for {$199053s1=1} Fire or Nature damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.800000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Windlash (wind_lash) 14260 1.1% 54.4 4.92sec 77647 59539 Direct 54.4 63200 126433 77649 22.8% 0.0%  

Stats details: wind_lash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.41 54.41 0.00 0.00 1.3041 0.0000 4224763.12 4224763.12 0.00 59538.93 59538.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.98 77.15% 63200.36 56501 67685 63242.74 60830 66203 2653125 2653125 0.00
crit 12.43 22.85% 126433.16 111331 135370 126536.60 120018 135370 1571638 1571638 0.00
 
 

Action details: wind_lash

Static Values
  • id:114089
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114089
  • name:Windlash
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals $sw1 Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Windlash Off-Hand (wind_lash_offhand) 7143 0.5% 54.4 4.92sec 38887 29863 Direct 54.4 31599 63216 38886 23.1% 0.0%  

Stats details: wind_lash_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.43 54.43 0.00 0.00 1.3022 0.0000 2116699.70 2116699.70 0.00 29862.72 29862.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.88 76.95% 31599.31 28250 33842 31620.30 30489 33413 1323519 1323519 0.00
crit 12.55 23.05% 63215.50 56501 67685 63228.41 0 67685 793180 793180 0.00
 
 

Action details: wind_lash_offhand

Static Values
  • id:114093
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114093
  • name:Windlash Off-Hand
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals $sw1 Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Windfury Attack 73526 5.5% 183.4 3.31sec 119806 0 Direct 183.4 97295 195422 119809 22.9% 0.0%  

Stats details: windfury_attack

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 183.39 183.39 0.00 0.00 0.0000 0.0000 21971896.61 32300769.26 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 141.32 77.06% 97294.88 55855 200065 97516.63 80427 116669 13749405 20212928 31.98
crit 42.08 22.94% 195421.55 111710 400130 195931.25 141713 280003 8222491 12087841 31.98
 
 

Action details: windfury_attack

Static Values
  • id:25504
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Each of your main hand attacks has a {$33757h=20}% chance to trigger two extra attacks, dealing $25504sw2 Physical damage each.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Windfury Attack (_oh) 14727 1.1% 38.2 14.88sec 115156 0 Direct 38.2 93547 187202 115152 23.1% 0.0%  

Stats details: windfury_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.22 38.22 0.00 0.00 0.0000 0.0000 4401438.58 6470531.63 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.40 76.93% 93547.42 83783 100032 93592.76 90318 98794 2750572 4043601 31.98
crit 8.82 23.07% 187202.13 167566 200065 187236.83 170079 200065 1650867 2426930 31.98
 
 

Action details: windfury_attack_oh

Static Values
  • id:33750
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:33750
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:$@spelldesc8232
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Windstrike 0 (250263) 0.0% (18.4%) 54.3 4.91sec 1362761 1390833

Stats details: windstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.28 0.00 0.00 0.00 0.9798 0.0000 0.00 0.00 0.00 1390832.92 1390832.92
 
 

Action details: windstrike

Static Values
  • id:115356
  • school:physical
  • resource:maelstrom
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(variable.heartEquipped|set_bonus.tier19_2pc)&(!talent.earthen_spike.enabled|(cooldown.earthen_spike.remains>1&cooldown.doom_winds.remains>1)|debuff.earthen_spike.up)
Spelldata
  • id:115356
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:Hurl a staggering blast of wind at an enemy, dealing a total of ${$115357sw1+$115360sw1} Physical damage, bypassing armor.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
    Windstrike (_mh) 166821 12.3% 67.8 4.91sec 726832 0 Direct 67.8 483418 1149167 726913 36.6% 0.0%  

Stats details: windstrike_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 67.83 67.82 0.00 0.00 0.0000 0.0000 49303265.59 49303265.59 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.02 63.42% 483417.69 190032 765747 484795.81 384349 583602 20795284 20795284 0.00
crit 24.81 36.58% 1149167.41 380063 1531494 1151635.74 893466 1330567 28507982 28507982 0.00
 
 

Action details: windstrike_mh

Static Values
  • id:115357
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115357
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of ${$115357sw1+$115360sw1} Physical damage, bypassing armor.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:7.50
 
    Windstrike Off-Hand 83442 6.1% 67.8 4.91sec 363578 0 Direct 67.8 241973 573341 363613 36.7% 0.0%  

Stats details: windstrike_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 67.83 67.82 0.00 0.00 0.0000 0.0000 24662619.78 24662619.78 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.92 63.29% 241973.00 95016 382874 242716.42 197389 294334 10386655 10386655 0.00
crit 24.90 36.71% 573340.59 190032 765747 574721.62 439315 676784 14275965 14275965 0.00
 
 

Action details: windstrike_offhand

Static Values
  • id:115360
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115360
  • name:Windstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of ${$115357sw1+$115360sw1} Physical damage, bypassing armor.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:7.50
 
pet - frost_wolf 313023 / 19512
Frozen Bite 143142 0.7% 8.1 29.99sec 330593 0 Direct 8.1 268927 538565 330582 22.9% 0.0%  

Stats details: frozen_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.06 8.06 0.00 0.00 0.0000 0.0000 2666211.52 2666211.52 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.22 77.13% 268927.49 236633 294910 267265.38 0 294910 1672739 1672739 0.00
crit 1.84 22.87% 538564.82 473265 589819 433712.23 0 589819 993472 993472 0.00
 
 

Action details: frozen_bite

Static Values
  • id:224126
  • school:frost
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224126
  • name:Frozen Bite
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Bite the target, causing {$s1=1} Frost damage and slowing the target's movement speed by {$s2=50}% for {$d=4 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
melee 102460 0.5% 46.8 4.58sec 40532 48359 Direct 46.8 32790 65572 40537 23.6% 0.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.85 46.85 0.00 0.00 0.8382 0.0000 1898813.95 2791436.36 31.98 48358.94 48358.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.78 76.38% 32790.34 28640 35693 32731.11 30098 35693 1173294 1724853 31.98
crit 11.06 23.62% 65572.35 57279 71386 65353.29 0 71386 725520 1066584 31.92
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Snowstorm 67421 0.3% 14.0 15.17sec 89375 0 Direct 14.0 72158 144389 89375 23.8% 0.0%  

Stats details: snowstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.01 14.01 0.00 0.00 0.0000 0.0000 1251858.40 1251858.40 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.67 76.16% 72157.70 63102 78642 71620.34 0 78642 769717 769717 0.00
crit 3.34 23.84% 144389.36 126203 157284 133214.08 0 157284 482141 482141 0.00
 
 

Action details: snowstorm

Static Values
  • id:198483
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198483
  • name:Snowstorm
  • school:frost
  • tooltip:
  • description:Deals {$s1=0} Frost damage to all targets within $A1 yards.
 
pet - fiery_wolf 388186 / 24387
Fiery Jaws 218960 1.0% 8.2 30.35sec 505680 0 Direct 8.2 179146 358248 221652 23.7% 0.0%  
Periodic 32.3 71809 0 71809 0.0% 0.0% 10.8%

Stats details: fiery_jaws

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.18 8.18 32.35 32.35 0.0000 1.0000 4135435.09 4135435.09 0.00 127842.06 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.24 76.28% 179146.06 157756 196607 178282.02 0 196607 1117483 1117483 0.00
crit 1.94 23.72% 358247.73 315511 393214 299777.49 0 393214 695030 695030 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.3 100.00% 71809.49 63103 78644 71598.65 0 78158 2322923 2322923 0.00
 
 

Action details: fiery_jaws

Static Values
  • id:224125
  • school:fire
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224125
  • name:Fiery Jaws
  • school:fire
  • tooltip:Suffering {$s2=1} Fire damage every $t sec.
  • description:Bite the target for {$s1=1} Fire damage, causing an additional $o2 Fire damage over {$d=4 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.400000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Fire Nova 67372 0.3% 14.3 15.29sec 89052 0 Direct 14.3 72098 144274 89051 23.5% 0.0%  

Stats details: fire_nova

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.26 14.26 0.00 0.00 0.0000 0.0000 1269469.97 1269469.97 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.91 76.51% 72097.98 63102 78642 71671.81 0 78642 786355 786355 0.00
crit 3.35 23.49% 144273.89 126203 157284 133338.83 0 157284 483115 483115 0.00
 
 

Action details: fire_nova

Static Values
  • id:198480
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198480
  • name:Fire Nova
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to all targets within $A1 yards.
 
melee 101854 0.5% 47.4 4.60sec 40379 48117 Direct 47.4 32769 65502 40381 23.2% 0.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.44 47.44 0.00 0.00 0.8392 0.0000 1915545.94 2816033.98 31.98 48117.21 48117.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.41 76.75% 32768.93 28640 35693 32718.30 30050 35693 1193104 1753975 31.98
crit 11.03 23.25% 65501.85 57279 71386 65227.19 0 71386 722442 1062059 31.87
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lightning_wolf 248536 / 15044
melee 147453 0.7% 47.3 4.52sec 56395 66970 Direct 47.3 45617 91573 56396 23.5% 0.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.26 47.26 0.00 0.00 0.8421 0.0000 2665148.59 3918020.88 31.98 66970.26 66970.26
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.18 76.55% 45617.10 28640 53539 45571.37 40597 53539 1650188 2425933 31.98
crit 11.08 23.45% 91572.73 57279 107079 91314.53 0 107079 1014961 1492088 31.94
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Thunder Bite 101083 0.5% 14.2 14.80sec 129125 0 Direct 14.2 104344 208707 129124 23.7% 0.0%  

Stats details: thunder_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.16 14.16 0.00 0.00 0.0000 0.0000 1828136.50 1828136.50 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.80 76.26% 104344.01 63102 117963 104120.12 0 117963 1126493 1126493 0.00
crit 3.36 23.74% 208707.37 126203 235926 194131.88 0 235926 701643 701643 0.00
 
 

Action details: thunder_bite

Static Values
  • id:198485
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198485
  • name:Thunder Bite
  • school:nature
  • tooltip:
  • description:Deals {$s1=0} Nature damage, jumping to up to $x targets.
 
Simple Action Stats Execute Interval
T20 4pc
Ascendance 2.0 185.34sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.04 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114051
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.doom_winds.up
Spelldata
  • id:114051
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a $114089r yard range. Stormstrike is empowered and has a $114089r yard range.
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, reducing the cooldown and cost of Stormstrike by {$s4=80}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$s1=30} yd range.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T20 4pc
  • harmful:false
  • if_expr:
 
Berserking 2.0 189.80sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.03 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ascendance.up|(feral_spirit.remains>5)|level<100
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Doom Winds 5.3 61.73sec

Stats details: doom_winds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.34 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: doom_winds

Static Values
  • id:204945
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:debuff.earthen_spike.up&talent.earthen_spike.enabled|!talent.earthen_spike.enabled
Spelldata
  • id:204945
  • name:Doom Winds
  • school:physical
  • tooltip:Chance to proc Windfury weapon on auto attacks increased by 100%. Windfury damage increased by {$s2=200}%.
  • description:Unleashes the inner power of the |cFFFFCC99Doomhammer|r, causing all auto attacks to trigger Windfury, and increasing damage dealt by Windfury by {$s2=200}% for {$d=6 seconds}.
 
Feral Spirit 3.0 121.16sec

Stats details: feral_spirit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 0.00 0.00 1.0191 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: feral_spirit

Static Values
  • id:51533
  • school:nature
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects$?a231723[ and grant you {$190185s1=5} Maelstrom each time they attack][].
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T20 4pc
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:T20 4pc
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
pet - lightning_wolf
Crackling Surge 8.2 29.60sec

Stats details: crackling_surge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.21 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: crackling_surge

Static Values
  • id:224127
  • school:nature
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224127
  • name:Crackling Surge
  • school:nature
  • tooltip:Damage dealt increased by {$s1=50}%.
  • description:The Doom Wolf surges with electric energy, increasing all damage dealt by {$s1=50}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 6.4 0.1 47.8sec 46.6sec 27.28% 87.90% 0.1(0.1) 6.1

Buff details

  • buff initial source:T20 4pc
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:27.28%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114051
  • name:Ascendance
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a $114089r yard range. Stormstrike is empowered and has a $114089r yard range.
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, reducing the cooldown and cost of Stormstrike by {$s4=80}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$s1=30} yd range.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Berserking 2.0 0.0 189.9sec 189.9sec 6.80% 11.70% 0.0(0.0) 2.0

Buff details

  • buff initial source:T20 4pc
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.58% 13.58% 0.0(0.0) 1.0

Buff details

  • buff initial source:T20 4pc
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Chill of the Twisting Nether 1.1 929.2 158.4sec 0.3sec 99.26% 99.36% 929.2(929.2) 0.1

Buff details

  • buff initial source:T20 4pc
  • cooldown name:buff_chill_of_the_twisting_nether
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02

Stack Uptimes

  • chill_of_the_twisting_nether_1:99.26%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:207998
  • name:Chill of the Twisting Nether
  • tooltip:All damage done increased by ${{$s1=15}/10}.1%.
  • description:{$@spelldesc207994=Damaging enemies with your Fire, Frost, or Nature abilities increases all damage you deal by ${{$207995s1=15}/10}.1% for {$207995d=8 seconds}. Each element adds a separate application.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Concordance of the Legionfall 8.4 3.1 35.3sec 24.9sec 32.35% 32.35% 3.1(3.1) 8.0

Buff details

  • buff initial source:T20 4pc
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Crashing Lightning 19.2 140.8 15.8sec 1.9sec 75.97% 86.89% 11.5(11.5) 0.0

Buff details

  • buff initial source:T20 4pc
  • cooldown name:buff_crashing_lightning
  • max_stacks:15
  • duration:16.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.35

Stack Uptimes

  • crashing_lightning_1:9.42%
  • crashing_lightning_2:10.12%
  • crashing_lightning_3:8.28%
  • crashing_lightning_4:7.38%
  • crashing_lightning_5:6.54%
  • crashing_lightning_6:5.70%
  • crashing_lightning_7:4.95%
  • crashing_lightning_8:4.31%
  • crashing_lightning_9:3.65%
  • crashing_lightning_10:3.02%
  • crashing_lightning_11:2.49%
  • crashing_lightning_12:2.02%
  • crashing_lightning_13:1.59%
  • crashing_lightning_14:1.29%
  • crashing_lightning_15:5.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242286
  • name:Crashing Lightning
  • tooltip:Damage done by your next Crash Lightning increased by {$s1=35}%.
  • description:{$@spelldesc242285=Stormstrike increases the initial damage of your next Crash Lightning by {$242286s1=35}%, stacking up to {$242286u=15} times.}
  • max_stacks:15
  • duration:16.00
  • cooldown:0.00
  • default_chance:101.00%
Doom Winds 5.3 0.0 61.7sec 61.7sec 10.50% 19.03% 0.0(0.0) 5.2

Buff details

  • buff initial source:T20 4pc
  • cooldown name:buff_doom_winds
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • doom_winds_1:10.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:204945
  • name:Doom Winds
  • tooltip:Chance to proc Windfury weapon on auto attacks increased by 100%. Windfury damage increased by {$s2=200}%.
  • description:Unleashes the inner power of the |cFFFFCC99Doomhammer|r, causing all auto attacks to trigger Windfury, and increasing damage dealt by Windfury by {$s2=200}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:60.00
  • default_chance:0.00%
Fire of the Twisting Nether 1.0 1130.4 210.0sec 0.3sec 99.62% 99.70% 1130.4(1130.4) 0.0

Buff details

  • buff initial source:T20 4pc
  • cooldown name:buff_fire_of_the_twisting_nether
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02

Stack Uptimes

  • fire_of_the_twisting_nether_1:99.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:207995
  • name:Fire of the Twisting Nether
  • tooltip:All damage done increased by ${{$s1=15}/10}.1%.
  • description:{$@spelldesc207994=Damaging enemies with your Fire, Frost, or Nature abilities increases all damage you deal by ${{$207995s1=15}/10}.1% for {$207995d=8 seconds}. Each element adds a separate application.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Flametongue 6.0 13.6 51.0sec 15.6sec 97.91% 98.04% 31.5(31.5) 5.0

Buff details

  • buff initial source:T20 4pc
  • cooldown name:buff_flametongue
  • max_stacks:1
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • flametongue_1:97.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194084
  • name:Flametongue
  • tooltip:Each of your weapon attacks causes up to ${$<coeff>*$AP} additional Fire damage.
  • description:{$@spelldesc193796=Scorches your target, dealing {$s2=1} Fire damage, and enhances your weapons with fire for {$194084d=16 seconds}, causing each weapon attack to deal up to ${$<coeff>*$AP} Fire damage, based on weapon speed.}
  • max_stacks:0
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
Frostbrand 8.1 10.7 37.4sec 16.3sec 96.33% 96.64% 47.4(47.4) 7.2

Buff details

  • buff initial source:T20 4pc
  • cooldown name:buff_frostbrand
  • max_stacks:1
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • frostbrand_1:96.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196834
  • name:Frostbrand
  • tooltip:Melee attacks reduce target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
  • description:Chills your target, dealing {$s1=1} Frost damage and reducing the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}, and enhances your weapons with frost for {$d=16 seconds}, causing each weapon attack to reduce the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
  • max_stacks:0
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
Gathering Storms 19.4 1.9 15.7sec 14.2sec 22.80% 15.05% 1.9(1.9) 0.0

Buff details

  • buff initial source:T20 4pc
  • cooldown name:buff_gathering_storms
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • gathering_storms_1:22.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:198300
  • name:Gathering Storms
  • tooltip:Damage of Stormstrike increased by $w1%.
  • description:{$@spelldesc198299=Each target hit by Crash Lightning increases damage dealt by your next Stormstrike within {$198300d=12 seconds} by {$s1=2}%.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Landslide 8.7 47.3 34.2sec 5.3sec 95.61% 88.84% 47.3(47.3) 7.7

Buff details

  • buff initial source:T20 4pc
  • cooldown name:buff_landslide
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • landslide_1:95.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202004
  • name:Landslide
  • tooltip:Agility increased by {$s1=8}%.
  • description:{$@spelldesc197992=$?s201897[Boulderfist][Rockbiter] enhances your weapon, increasing your Agility by {$202004s1=8}% for {$202004d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Lightning Crash 13.0 8.2 23.4sec 14.2sec 87.56% 51.49% 8.2(8.2) 12.1

Buff details

  • buff initial source:T20 4pc
  • cooldown name:buff_lightning_crash
  • max_stacks:1
  • duration:16.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.05

Stack Uptimes

  • lightning_crash_1:87.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242284
  • name:Lightning Crash
  • tooltip:Critical strike chance increased by {$s1=5}%.
  • description:{$@spelldesc242283=Crash Lightning increases your critical strike chance by {$242284s1=5}% for {$242284d=16 seconds}.}
  • max_stacks:0
  • duration:16.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 105.5sec 0.0sec 40.03% 40.03% 0.0(0.0) 2.0

Buff details

  • buff initial source:T20 4pc
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:40.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Shock of the Twisting Nether 2.0 212.3 121.5sec 1.4sec 99.37% 99.28% 212.3(212.3) 1.0

Buff details

  • buff initial source:T20 4pc
  • cooldown name:buff_shock_of_the_twisting_nether
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02

Stack Uptimes

  • shock_of_the_twisting_nether_1:99.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:207999
  • name:Shock of the Twisting Nether
  • tooltip:All damage done increased by ${{$s1=15}/10}.1%.
  • description:{$@spelldesc207994=Damaging enemies with your Fire, Frost, or Nature abilities increases all damage you deal by ${{$207995s1=15}/10}.1% for {$207995d=8 seconds}. Each element adds a separate application.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 64.1 7.1 4.6sec 4.2sec 20.61% 49.95% 10.9(11.4) 0.0

Buff details

  • buff initial source:T20 4pc
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormbringer_1:20.61%

Trigger Attempt Success

  • trigger_pct:94.12%

Spelldata details

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike has no cooldown and its cost is reduced by {$s3=50}%.
  • description:{$@spelldesc201845=Your weapon attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike, and cause your next Stormstrike to cost {$201846s3=50}% less Maelstrom and trigger no cooldown.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Stormlash 14.2 10.5 21.6sec 12.1sec 50.41% 50.41% 10.5(10.5) 13.7

Buff details

  • buff initial source:T20 4pc
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormlash_1:50.41%

Trigger Attempt Success

  • trigger_pct:99.88%

Spelldata details

  • id:195222
  • name:Stormlash
  • tooltip:Empowered with lightning. Attacks and spellcasts have a chance to deal additional Nature damage.
  • description:{$@spelldesc195255=While your weapons are enhanced, your attacks have a chance to grant Stormlash to up to {$?s210731=false}[${$m1+$210731m1}][{$s1=2}] party or raid members for {$195222d=8 seconds}, causing attacks and spellcasts to deal additional Nature damage.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Unleash Doom 15.6 16.3 19.2sec 9.2sec 44.42% 50.60% 16.3(16.3) 15.1

Buff details

  • buff initial source:T20 4pc
  • cooldown name:buff_unleash_doom
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-0.00

Stack Uptimes

  • unleash_doom_1:44.42%

Trigger Attempt Success

  • trigger_pct:19.97%

Spelldata details

  • id:199055
  • name:Unleash Doom
  • tooltip:Your special attacks will trigger an arc of fiery or lightning damage at your target.
  • description:{$@spelldesc198736=Stormstrike has a chance to unleash the power of |cFFFFCC99Doomhammer|r, causing your special attacks to heave molten lava or lightning spikes at your target for {$199053s1=1} Fire or Nature damage.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Wind Strikes 16.3 54.8 18.6sec 4.2sec 71.07% 78.64% 55.4(59.2) 15.6

Buff details

  • buff initial source:T20 4pc
  • cooldown name:buff_wind_strikes
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.85

Stack Uptimes

  • wind_strikes_1:71.07%

Trigger Attempt Success

  • trigger_pct:94.11%

Spelldata details

  • id:198293
  • name:Wind Strikes
  • tooltip:Attack speed increased by $w1%.
  • description:{$@spelldesc198292=When Stormbringer resets the remaining cooldown on Stormstrike, you gain {$s1=3}% attack speed for {$198293d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
fiery_wolf: Alpha Wolf 1.6 0.5 100.1sec 56.8sec 73.04% 73.04% 7.6(7.6) 0.8

Buff details

  • buff initial source:T20 4pc_fiery_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:73.04%

Trigger Attempt Success

  • trigger_pct:98.76%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
fiery_wolf: Alpha Wolf 1.6 0.8 111.4sec 47.6sec 75.66% 75.66% 8.1(8.1) 0.6

Buff details

  • buff initial source:T20 4pc_fiery_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:75.66%

Trigger Attempt Success

  • trigger_pct:98.91%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
frost_wolf: Alpha Wolf 1.6 0.5 99.0sec 56.2sec 72.34% 72.34% 7.4(7.4) 0.8

Buff details

  • buff initial source:T20 4pc_frost_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:72.34%

Trigger Attempt Success

  • trigger_pct:99.04%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
frost_wolf: Alpha Wolf 1.6 0.9 109.6sec 47.1sec 75.85% 75.85% 8.2(8.2) 0.6

Buff details

  • buff initial source:T20 4pc_frost_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:75.85%

Trigger Attempt Success

  • trigger_pct:98.72%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Alpha Wolf 1.6 0.6 99.3sec 54.9sec 72.73% 72.73% 7.6(7.6) 0.7

Buff details

  • buff initial source:T20 4pc_lightning_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:72.73%

Trigger Attempt Success

  • trigger_pct:99.26%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Alpha Wolf 1.6 0.9 105.7sec 44.4sec 76.02% 76.02% 8.1(8.1) 0.6

Buff details

  • buff initial source:T20 4pc_lightning_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:76.02%

Trigger Attempt Success

  • trigger_pct:99.02%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Crackling Surge 4.2 0.0 23.2sec 23.2sec 76.04% 71.00% 0.0(0.0) 2.8

Buff details

  • buff initial source:T20 4pc_lightning_wolf
  • cooldown name:buff_crackling_surge
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • crackling_surge_1:76.04%

Trigger Attempt Success

  • trigger_pct:99.77%

Spelldata details

  • id:224127
  • name:Crackling Surge
  • tooltip:Damage dealt increased by {$s1=50}%.
  • description:The Doom Wolf surges with electric energy, increasing all damage dealt by {$s1=50}%.
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Crackling Surge 4.1 0.0 22.3sec 22.3sec 76.02% 71.01% 0.0(0.0) 2.7

Buff details

  • buff initial source:T20 4pc_lightning_wolf
  • cooldown name:buff_crackling_surge
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • crackling_surge_1:76.02%

Trigger Attempt Success

  • trigger_pct:99.77%

Spelldata details

  • id:224127
  • name:Crackling Surge
  • tooltip:Damage dealt increased by {$s1=50}%.
  • description:The Doom Wolf surges with electric energy, increasing all damage dealt by {$s1=50}%.
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:T20 4pc
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:T20 4pc
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:T20 4pc
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201639
  • name:Well Fed
  • tooltip:Agility increased by $w1.
  • description:Agility increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Strength of Will

Buff details

  • buff initial source:T20 4pc
  • cooldown name:buff_strength_of_will
  • max_stacks:10
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:304.77

Stack Uptimes

  • strength_of_will_10:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242642
  • name:Strength of Will
  • tooltip:Strength or Agility increased by {$s3=95}, based on your specialization.
  • description:{$@spelldesc242640=While you are above {$s1=80}% health you gain {$242642s3=95} Strength or Agility per second, based on your specialization, stacking up to {$242642u=10} times. If you fall below {$s2=50}% health, this effect is lost.}
  • max_stacks:10
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
Flametongue: Windfury Attack 218.7 2.8sec
Frostbrand: Windfury Attack 216.3 2.8sec
Maelstrom Weapon: Windfury Attack 221.6 2.7sec
Stormbringer: Windfury Attack 13.7 21.6sec
Stormbringer: Windfury Attack Off-Hand 2.8 73.7sec
Flametongue: main_hand 105.8 2.8sec
Frostbrand: main_hand 104.0 2.8sec
Maelstrom Weapon: main_hand 107.7 2.8sec
Stormbringer: main_hand 8.0 31.4sec
Windfury: main_hand 30.5 9.3sec
Flametongue: Windlash 52.5 5.1sec
Frostbrand: Windlash 51.1 5.3sec
Maelstrom Weapon: Windlash 54.4 5.0sec
Stormbringer: Windlash 4.0 53.4sec
Windfury: Windlash 20.7 12.9sec
Flametongue: offhand 105.4 2.8sec
Frostbrand: offhand 104.5 2.8sec
Maelstrom Weapon: offhand 107.4 2.8sec
Stormbringer: offhand 7.9 31.7sec
Windfury: offhand 8.2 25.5sec
Flametongue: Windlash Off-Hand 52.5 5.1sec
Frostbrand: Windlash Off-Hand 51.1 5.3sec
Maelstrom Weapon: Windlash Off-Hand 54.4 5.0sec
Stormbringer: Windlash Off-Hand 4.0 53.7sec
Windfury: Windlash Off-Hand 11.0 21.4sec
Flametongue: Windstrike 64.9 5.2sec
Frostbrand: Windstrike 63.0 5.3sec
Stormbringer: Windstrike 5.0 45.5sec
Windfury: Windstrike 15.2 18.4sec
Unleash Doom (damage): Windstrike 46.3 7.1sec
Flametongue: Windstrike Off-Hand 64.9 5.2sec
Frostbrand: Windstrike Off-Hand 63.0 5.3sec
Stormbringer: Windstrike Off-Hand 5.0 45.0sec
Unleash Doom (damage): Windstrike Off-Hand 46.3 7.1sec
Stormbringer: Rockbiter 4.2 52.7sec
Unleash Doom (damage): Rockbiter 23.4 12.2sec
Flametongue: Crash Lightning 21.3 14.2sec
Frostbrand: Crash Lightning 21.2 14.2sec
Stormbringer: Crash Lightning 1.6 86.3sec
Windfury: Crash Lightning 4.7 51.5sec
Unleash Doom (damage): Crash Lightning 8.4 33.8sec
Stormbringer: Flametongue 1.4 89.3sec
Unleash Doom (damage): Flametongue 8.3 33.7sec
Stormbringer: Frostbrand 1.4 89.3sec
Unleash Doom (damage): Frostbrand 7.7 36.1sec
Flametongue: Stormstrike 92.1 3.8sec
Frostbrand: Stormstrike 92.1 3.8sec
Stormbringer: Stormstrike 6.8 34.1sec
Windfury: Stormstrike 20.6 13.7sec
Unleash Doom (damage): Stormstrike 51.6 6.5sec
Flametongue: Stormstrike Off-Hand 92.1 3.8sec
Frostbrand: Stormstrike Off-Hand 92.1 3.8sec
Stormbringer: Stormstrike Off-Hand 6.9 34.0sec
Unleash Doom (damage): Stormstrike Off-Hand 51.6 6.5sec
Flametongue: Lava Lash 38.3 7.4sec
Frostbrand: Lava Lash 38.3 7.4sec
Stormbringer: Lava Lash 2.9 65.1sec
Unleash Doom (damage): Lava Lash 11.0 23.9sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Windstrike0.7790.0017.99144.3949.708102.634
Feral Spirit1.2220.00121.5182.2280.00021.518
Doom Winds1.7340.00137.7557.3200.59039.701
Ascendance5.2120.21939.7015.4190.21939.701
Rockbiter3.5990.00119.43263.90624.860123.999
Crash Lightning10.2580.00164.131203.139127.412281.791
Flametongue7.2390.00129.876133.84388.142179.062
Stormstrike1.3890.00111.017113.16038.776212.678

Resources

Resource Usage Type Count Total Average RPE APR
T20 4pc
crash_lightning Maelstrom 36.4 728.2 20.0 34.2 26472.0
frostbrand Maelstrom 32.2 644.1 20.0 34.2 58150.8
lava_lash Maelstrom 65.6 1968.2 30.0 51.3 17742.5
stormstrike Maelstrom 157.7 3656.3 23.2 49.6 19830.9
windstrike Maelstrom 116.1 583.0 5.0 10.7 126878.6
Resource Gains Type Count Total Average Overflow
Windfury Attack Maelstrom 379.24 2093.09 (27.08%) 5.52 561.59 21.15%
Main Hand Maelstrom 184.25 890.35 (11.52%) 4.83 30.91 3.36%
Windlash Maelstrom 93.12 352.91 (4.57%) 3.79 112.69 24.20%
Off-Hand Maelstrom 183.73 885.35 (11.46%) 4.82 33.30 3.63%
Windlash Off-Hand Maelstrom 93.15 348.53 (4.51%) 3.74 117.24 25.17%
Feral Spirit Maelstrom 171.08 557.50 (7.21%) 3.26 297.89 34.83%
Rockbiter Maelstrom 95.92 2600.80 (33.65%) 27.11 180.98 6.51%
Resource RPS-Gain RPS-Loss
Maelstrom 15.03 14.74
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 88.02 0.00 150.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data T20 4pc Fight Length
Count 2499
Mean 300.56
Minimum 203.03
Maximum 426.52
Spread ( max - min ) 223.49
Range [ ( max - min ) / 2 * 100% ] 37.18%
Standard Deviation 41.9271
5th Percentile 235.82
95th Percentile 369.07
( 95th Percentile - 5th Percentile ) 133.25
Mean Distribution
Standard Deviation 0.8387
95.00% Confidence Intervall ( 298.92 - 302.21 )
Normalized 95.00% Confidence Intervall ( 99.45% - 100.55% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 748
0.1% Error 74752
0.1 Scale Factor Error with Delta=300 16
0.05 Scale Factor Error with Delta=300 61
0.01 Scale Factor Error with Delta=300 1501
DPS
Sample Data T20 4pc Damage Per Second
Count 2499
Mean 1342480.73
Minimum 1109788.71
Maximum 1648376.56
Spread ( max - min ) 538587.85
Range [ ( max - min ) / 2 * 100% ] 20.06%
Standard Deviation 72415.6574
5th Percentile 1233903.90
95th Percentile 1470116.06
( 95th Percentile - 5th Percentile ) 236212.16
Mean Distribution
Standard Deviation 1448.6029
95.00% Confidence Intervall ( 1339641.52 - 1345319.94 )
Normalized 95.00% Confidence Intervall ( 99.79% - 100.21% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 112
0.1% Error 11178
0.1 Scale Factor Error with Delta=300 44766035
0.05 Scale Factor Error with Delta=300 179064138
0.01 Scale Factor Error with Delta=300 4476603439
Priority Target DPS
Sample Data T20 4pc Priority Target Damage Per Second
Count 2499
Mean 1342529.36
Minimum 1118117.61
Maximum 1628378.14
Spread ( max - min ) 510260.53
Range [ ( max - min ) / 2 * 100% ] 19.00%
Standard Deviation 70751.8032
5th Percentile 1233939.13
95th Percentile 1463458.22
( 95th Percentile - 5th Percentile ) 229519.09
Mean Distribution
Standard Deviation 1415.3192
95.00% Confidence Intervall ( 1339755.39 - 1345303.34 )
Normalized 95.00% Confidence Intervall ( 99.79% - 100.21% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 107
0.1% Error 10669
0.1 Scale Factor Error with Delta=300 42732539
0.05 Scale Factor Error with Delta=300 170930155
0.01 Scale Factor Error with Delta=300 4273253863
DPS(e)
Sample Data T20 4pc Damage Per Second (Effective)
Count 2499
Mean 1342480.73
Minimum 1109788.71
Maximum 1648376.56
Spread ( max - min ) 538587.85
Range [ ( max - min ) / 2 * 100% ] 20.06%
Damage
Sample Data T20 4pc Damage
Count 2499
Mean 389240746.57
Minimum 308779161.77
Maximum 470566027.77
Spread ( max - min ) 161786866.00
Range [ ( max - min ) / 2 * 100% ] 20.78%
DTPS
Sample Data T20 4pc Damage Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data T20 4pc Healing Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data T20 4pc Healing Per Second (Effective)
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data T20 4pc Heal
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data T20 4pc Healing Taken Per Second
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data T20 4pc Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data T20 4pcTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data T20 4pc Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 potion
5 0.00 lightning_shield
Default action list Executed every time the actor is available.
# count action,conditions
0.00 wind_shear
0.00 variable,name=hailstormCheck,value=((talent.hailstorm.enabled&!buff.frostbrand.up)|!talent.hailstorm.enabled)
0.00 variable,name=furyCheck80,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>80))
0.00 variable,name=furyCheck70,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>70))
0.00 variable,name=furyCheck45,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>45))
0.00 variable,name=furyCheck25,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>25))
0.00 variable,name=OCPool70,value=(!talent.overcharge.enabled|(talent.overcharge.enabled&maelstrom>70))
0.00 variable,name=OCPool60,value=(!talent.overcharge.enabled|(talent.overcharge.enabled&maelstrom>60))
0.00 variable,name=heartEquipped,value=(equipped.151819)
0.00 variable,name=akainuEquipped,value=(equipped.137084)
0.00 variable,name=akainuAS,value=(variable.akainuEquipped&buff.hot_hand.react&!buff.frostbrand.up)
0.00 variable,name=LightningCrashNotUp,value=(!buff.lightning_crash.up&set_bonus.tier20_2pc)
0.00 variable,name=alphaWolfCheck,value=((pet.frost_wolf.buff.alpha_wolf.remains<2&pet.fiery_wolf.buff.alpha_wolf.remains<2&pet.lightning_wolf.buff.alpha_wolf.remains<2)&feral_spirit.remains>4)
6 1.00 auto_attack
7 7.18 use_items
8 0.00 call_action_list,name=opener
9 54.32 windstrike,if=(variable.heartEquipped|set_bonus.tier19_2pc)&(!talent.earthen_spike.enabled|(cooldown.earthen_spike.remains>1&cooldown.doom_winds.remains>1)|debuff.earthen_spike.up)
A 0.00 call_action_list,name=buffs
B 0.00 call_action_list,name=CDs
C 0.00 call_action_list,name=core
D 0.00 call_action_list,name=filler
actions.CDs
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
E 2.03 berserking,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
0.00 blood_fury,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
F 1.00 potion,if=buff.ascendance.up|!talent.ascendance.enabled&feral_spirit.remains>5|target.time_to_die<=60
G 2.98 feral_spirit
H 5.34 doom_winds,if=debuff.earthen_spike.up&talent.earthen_spike.enabled|!talent.earthen_spike.enabled
I 2.04 ascendance,if=buff.doom_winds.up
actions.buffs
# count action,conditions
J 7.90 rockbiter,if=talent.landslide.enabled&!buff.landslide.up
0.00 fury_of_air,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
K 2.47 crash_lightning,if=artifact.alpha_wolf.rank&prev_gcd.1.feral_spirit
L 6.02 flametongue,if=!buff.flametongue.up
M 8.14 frostbrand,if=talent.hailstorm.enabled&!buff.frostbrand.up&variable.furyCheck45
N 2.40 flametongue,if=buff.flametongue.remains<6+gcd&cooldown.doom_winds.remains<gcd*2
O 2.66 frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<6+gcd&cooldown.doom_winds.remains<gcd*2
actions.core
# count action,conditions
0.00 earthen_spike,if=variable.furyCheck25
0.00 crash_lightning,if=!buff.crash_lightning.up&active_enemies>=2
0.00 windsong
0.00 crash_lightning,if=active_enemies>=8|(active_enemies>=6&talent.crashing_storm.enabled)
0.00 windstrike
P 40.68 stormstrike,if=buff.stormbringer.up&variable.furyCheck25
0.00 crash_lightning,if=active_enemies>=4|(active_enemies>=2&talent.crashing_storm.enabled)
0.00 lightning_bolt,if=talent.overcharge.enabled&variable.furyCheck45&maelstrom>=40
Q 33.12 stormstrike,if=(!talent.overcharge.enabled&variable.furyCheck45)|(talent.overcharge.enabled&variable.furyCheck80)
0.00 frostbrand,if=variable.akainuAS
0.00 lava_lash,if=buff.hot_hand.react&((variable.akainuEquipped&buff.frostbrand.up)|!variable.akainuEquipped)
0.00 sundering,if=active_enemies>=3
R 13.95 crash_lightning,if=active_enemies>=3|variable.LightningCrashNotUp|variable.alphaWolfCheck
actions.filler
# count action,conditions
S 47.37 rockbiter,if=maelstrom<120
T 9.25 flametongue,if=buff.flametongue.remains<4.8
0.00 rockbiter,if=maelstrom<=40
0.00 crash_lightning,if=(talent.crashing_storm.enabled|active_enemies>=2)&debuff.earthen_spike.up&maelstrom>=40&variable.OCPool60
U 8.03 frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<4.8&maelstrom>40
0.00 frostbrand,if=variable.akainuEquipped&!buff.frostbrand.up&maelstrom>=75
0.00 sundering
V 38.37 lava_lash,if=maelstrom>=50&variable.OCPool70&variable.furyCheck80
0.00 rockbiter
W 4.87 crash_lightning,if=(maelstrom>=65|talent.crashing_storm.enabled|active_enemies>=2)&variable.OCPool60&variable.furyCheck45
X 1.98 flametongue
actions.opener
# count action,conditions
Y 0.83 rockbiter,if=maelstrom<15&time<2

Sample Sequence

012467YLMGKEHI99V9R9V99999J9T9U9V9SQPPQRSSVVSTUVQSVVSVVWPPSPPP7PQSPLMSQPPRSQSWPNOHPQ99FS9V9999RQSTU99V9V9V79J9R9T9U9V9J999V999999999999J9L99M9GKHQJPQ7TPQRPQUJPQSVVSTVSUPQPQRSSVVSVPTSQUWSVPXSQ7WSUPSPQNHI9999ES999R999U99JQSTPPQSVRSUVSVT97999V9V9JQPQRMSTVSVVSQGKOHSV9T99999V9JPQRSS7MTVSVVQSVVPQSPPMRSQLSVSVPWP

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask T20 4pc 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom
Pre precombat 1 food T20 4pc 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom
Pre precombat 2 augmentation T20 4pc 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom potion_of_prolonged_power
0:00.000 default 6 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom potion_of_prolonged_power
0:00.000 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/150: 3% maelstrom potion_of_prolonged_power
0:00.000 opener Y rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/150: 3% maelstrom potion_of_prolonged_power
0:01.105 buffs L flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/150: 26% maelstrom bloodlust, stormbringer, landslide, wind_strikes, shock_of_the_twisting_nether, potion_of_prolonged_power
0:01.956 buffs M frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/150: 39% maelstrom bloodlust, flametongue, stormbringer, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, potion_of_prolonged_power
0:02.807 CDs G feral_spirit Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/150: 29% maelstrom bloodlust, flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:03.659 buffs K crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/150: 51% maelstrom bloodlust, flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:04.510 CDs E berserking Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/150: 45% maelstrom bloodlust, flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:04.510 CDs H doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/150: 45% maelstrom bloodlust, berserking, flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:04.510 CDs I ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/150: 45% maelstrom bloodlust, berserking, flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:04.510 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/150: 45% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:05.264 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/150: 74% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:06.018 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 132.0/150: 88% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(2), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:06.772 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 131.0/150: 87% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(2), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:07.527 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(3), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:08.282 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, unleash_doom, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:09.038 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, unleash_doom, stormlash, lightning_crash, crashing_lightning, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:09.794 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, unleash_doom, wind_strikes, lightning_crash, crashing_lightning, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:10.550 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(2), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:11.303 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, stormbringer, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(5), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:12.057 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, stormbringer, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(6), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:12.812 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(7), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:13.567 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(8), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:14.322 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(8), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:15.076 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(9), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:15.928 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(9), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:16.840 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(10), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:17.691 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 145.0/150: 97% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, lightning_crash, crashing_lightning(10), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:18.541 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 142.0/150: 95% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, unleash_doom, stormlash, lightning_crash, crashing_lightning(11), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:19.391 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/150: 81% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, unleash_doom, stormlash, lightning_crash, crashing_lightning(11), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:20.241 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/150: 79% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, stormlash, lightning_crash, crashing_lightning(12), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:21.091 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, stormlash, lightning_crash, crashing_lightning(12), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:21.944 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 129.0/150: 86% maelstrom bloodlust, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(14), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:22.796 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/150: 79% maelstrom bloodlust, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(15), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:23.648 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/150: 79% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, crashing_lightning(15), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:24.500 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/150: 55% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, crashing_lightning(15), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:25.351 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/150: 49% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:26.201 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/150: 68% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:27.050 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 141.0/150: 94% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:27.902 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/150: 77% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:28.755 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/150: 61% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:29.606 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom bloodlust, flametongue, frostbrand, landslide, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:30.458 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom bloodlust, flametongue, frostbrand, landslide, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:31.310 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom bloodlust, flametongue, frostbrand, landslide, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:32.163 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom bloodlust, flametongue, frostbrand, landslide, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:33.016 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/150: 43% maelstrom bloodlust, flametongue, frostbrand, landslide, lightning_crash, crashing_lightning, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:33.867 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/150: 65% maelstrom bloodlust, flametongue, frostbrand, landslide, lightning_crash, crashing_lightning, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:34.717 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/150: 49% maelstrom bloodlust, flametongue, frostbrand, landslide, stormlash, lightning_crash, crashing_lightning, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:35.567 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/150: 29% maelstrom bloodlust, flametongue, frostbrand, landslide, stormlash, lightning_crash, crashing_lightning, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:36.419 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/150: 55% maelstrom bloodlust, flametongue, frostbrand, landslide, stormlash, lightning_crash, crashing_lightning, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:37.270 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/150: 47% maelstrom bloodlust, flametongue, frostbrand, landslide, stormlash, lightning_crash, crashing_lightning, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:38.121 filler W crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/150: 31% maelstrom bloodlust, flametongue, frostbrand, landslide, stormlash, lightning_crash, crashing_lightning, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:38.975 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/150: 21% maelstrom bloodlust, flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:39.827 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom bloodlust, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:40.678 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom bloodlust, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(2), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:41.529 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/150: 33% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(2), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:42.635 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/150: 32% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(4), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:43.741 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/150: 35% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(5), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:44.847 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(7), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:44.847 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(7), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:45.954 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(8), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:47.061 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(9), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:48.167 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/150: 33% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(9), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:49.273 buffs L flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/150: 26% maelstrom frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(10), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:50.380 buffs M frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/150: 29% maelstrom flametongue, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(10), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:51.488 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/150: 19% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, crashing_lightning(10), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:52.594 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/150: 45% maelstrom flametongue, frostbrand, landslide, lightning_crash, crashing_lightning(10), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:53.700 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/150: 31% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, lightning_crash, crashing_lightning(11), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:54.804 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/150: 31% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, crashing_lightning(13), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:55.910 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/150: 24% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, crashing_lightning(14), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:57.017 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/150: 14% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:58.123 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
0:59.230 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:00.336 filler W crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/150: 29% maelstrom flametongue, frostbrand, landslide, lightning_crash, crashing_lightning, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:01.443 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/150: 23% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:02.547 buffs N flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/150: 22% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:03.652 buffs O frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/150: 25% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:04.757 CDs H doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/150: 25% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:04.757 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/150: 25% maelstrom flametongue, frostbrand, stormbringer, landslide, doom_winds, unleash_doom, wind_strikes, lightning_crash, crashing_lightning, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:05.864 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(2), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:06.970 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/150: 19% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(3), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:08.076 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/150: 51% maelstrom ascendance, flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(4), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:09.182 CDs F potion Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/150: 59% maelstrom ascendance, flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(5), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:09.182 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/150: 59% maelstrom ascendance, flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(5), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:10.287 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 136.0/150: 91% maelstrom ascendance, flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(5), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:11.394 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(6), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:12.501 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 139.0/150: 93% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(6), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:13.607 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 145.0/150: 97% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(7), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:14.713 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 142.0/150: 95% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(8), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:15.818 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(9), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:16.923 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 147.0/150: 98% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, crashing_lightning(10), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:18.028 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 132.0/150: 88% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:19.134 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/150: 65% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:20.241 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 136.0/150: 91% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, lightning_crash, crashing_lightning, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:21.345 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 141.0/150: 94% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, lightning_crash, crashing_lightning, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:22.451 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 126.0/150: 84% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, lightning_crash, crashing_lightning, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:23.557 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 132.0/150: 88% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(2), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:24.662 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 143.0/150: 95% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(3), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:25.766 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 132.0/150: 88% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(3), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:26.872 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 148.0/150: 99% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(4), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:27.979 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/150: 82% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, lightning_crash, crashing_lightning(4), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:29.087 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom ascendance, flametongue, frostbrand, landslide, lightning_crash, crashing_lightning(5), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:30.194 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom ascendance, flametongue, frostbrand, lightning_crash, crashing_lightning(5), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:30.194 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom ascendance, flametongue, frostbrand, lightning_crash, crashing_lightning(5), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:31.302 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/150: 61% maelstrom ascendance, flametongue, frostbrand, lightning_crash, crashing_lightning(6), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:32.406 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 131.0/150: 87% maelstrom ascendance, flametongue, frostbrand, landslide, lightning_crash, crashing_lightning(6), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:33.511 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 128.0/150: 85% maelstrom ascendance, flametongue, frostbrand, landslide, stormlash, crashing_lightning(7), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:34.617 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 127.0/150: 85% maelstrom ascendance, flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:35.722 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/150: 83% maelstrom ascendance, flametongue, frostbrand, landslide, stormlash, lightning_crash, crashing_lightning, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:36.827 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 129.0/150: 86% maelstrom ascendance, flametongue, frostbrand, landslide, stormlash, lightning_crash, crashing_lightning, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:37.932 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 126.0/150: 84% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, stormlash, lightning_crash, crashing_lightning(2), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:39.038 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, stormlash, lightning_crash, crashing_lightning(2), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:40.146 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 127.0/150: 85% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, stormlash, lightning_crash, crashing_lightning(3), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:41.252 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/150: 68% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, stormlash, lightning_crash, crashing_lightning(3), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:42.357 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 127.0/150: 85% maelstrom ascendance, flametongue, frostbrand, unleash_doom, stormlash, lightning_crash, crashing_lightning(5), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:43.461 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, lightning_crash, crashing_lightning(5), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:44.565 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, lightning_crash, crashing_lightning(7), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:45.670 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, crashing_lightning(8), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:46.775 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 147.0/150: 98% maelstrom ascendance, flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, crashing_lightning(9), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:47.880 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 127.0/150: 85% maelstrom ascendance, flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, crashing_lightning(9), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:48.984 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 138.0/150: 92% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, lightning_crash, crashing_lightning(10), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:50.089 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 144.0/150: 96% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, crashing_lightning(11), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:51.197 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 145.0/150: 97% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, crashing_lightning(12), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:52.302 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 142.0/150: 95% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, crashing_lightning(13), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:53.408 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, frostbrand, unleash_doom, wind_strikes, stormlash, crashing_lightning(14), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:54.512 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 147.0/150: 98% maelstrom ascendance, stormbringer, unleash_doom, wind_strikes, stormlash, crashing_lightning(15), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:55.618 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, stormbringer, unleash_doom, wind_strikes, stormlash, crashing_lightning(15), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:56.723 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, unleash_doom, wind_strikes, stormlash, crashing_lightning(15), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:57.826 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, stormbringer, unleash_doom, wind_strikes, stormlash, crashing_lightning(15), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:58.932 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, stormbringer, unleash_doom, wind_strikes, crashing_lightning(15), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:00.036 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, unleash_doom, wind_strikes, crashing_lightning(15), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:01.141 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, unleash_doom, wind_strikes, crashing_lightning(15), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:02.246 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, landslide, unleash_doom, wind_strikes, crashing_lightning(15), fire_of_the_twisting_nether, shock_of_the_twisting_nether, potion_of_prolonged_power
2:03.352 buffs L flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, landslide, unleash_doom, wind_strikes, crashing_lightning(15), fire_of_the_twisting_nether, shock_of_the_twisting_nether, potion_of_prolonged_power
2:04.457 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, crashing_lightning(15), fire_of_the_twisting_nether, shock_of_the_twisting_nether, potion_of_prolonged_power
2:05.560 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, landslide, unleash_doom, wind_strikes, stormlash, crashing_lightning(15), fire_of_the_twisting_nether, shock_of_the_twisting_nether, potion_of_prolonged_power
2:06.665 buffs M frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 147.0/150: 98% maelstrom ascendance, flametongue, landslide, unleash_doom, wind_strikes, stormlash, crashing_lightning(15), fire_of_the_twisting_nether, shock_of_the_twisting_nether, potion_of_prolonged_power
2:07.770 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 132.0/150: 88% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, crashing_lightning(15), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:08.874 CDs G feral_spirit Fluffy_Pillow 220000.0/220000: 100% mana | 148.0/150: 99% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, crashing_lightning(15), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:09.980 buffs K crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, unleash_doom, stormlash, crashing_lightning(15), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:11.087 CDs H doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 145.0/150: 97% maelstrom flametongue, frostbrand, landslide, unleash_doom, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:11.087 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 145.0/150: 97% maelstrom flametongue, frostbrand, landslide, doom_winds, unleash_doom, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:12.194 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 148.0/150: 99% maelstrom flametongue, frostbrand, stormbringer, doom_winds, wind_strikes, lightning_crash, crashing_lightning, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:13.299 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, lightning_crash, crashing_lightning, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:14.405 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, doom_winds, wind_strikes, lightning_crash, crashing_lightning(2), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:15.511 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, doom_winds, wind_strikes, lightning_crash, crashing_lightning(3), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:15.511 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, doom_winds, wind_strikes, lightning_crash, crashing_lightning(3), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:16.615 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, lightning_crash, crashing_lightning(3), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:17.720 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, wind_strikes, lightning_crash, crashing_lightning(4), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:18.827 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom flametongue, frostbrand, landslide, wind_strikes, lightning_crash, crashing_lightning(5), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:19.933 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 134.0/150: 89% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:21.037 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 148.0/150: 99% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:22.144 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 133.0/150: 89% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(2), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:23.250 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 128.0/150: 85% maelstrom flametongue, frostbrand, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(2), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:24.353 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(2), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:25.459 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(3), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:26.563 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/150: 76% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(5), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:27.668 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, wind_strikes, lightning_crash, crashing_lightning(5), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:28.772 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, landslide, wind_strikes, lightning_crash, crashing_lightning(5), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:29.878 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, landslide, lightning_crash, crashing_lightning(5), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:30.985 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 129.0/150: 86% maelstrom flametongue, frostbrand, landslide, lightning_crash, crashing_lightning(5), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:32.091 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 134.0/150: 89% maelstrom flametongue, frostbrand, landslide, lightning_crash, crashing_lightning(5), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:33.196 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/150: 69% maelstrom flametongue, frostbrand, landslide, lightning_crash, crashing_lightning(5), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:34.300 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 138.0/150: 92% maelstrom flametongue, frostbrand, landslide, lightning_crash, crashing_lightning(5), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:35.406 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/150: 82% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, crashing_lightning(5), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:36.513 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/150: 72% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, crashing_lightning(7), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:37.618 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/150: 49% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, crashing_lightning(8), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:38.724 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/150: 42% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, crashing_lightning(9), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:39.830 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/150: 19% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, crashing_lightning(10), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:40.934 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/150: 9% maelstrom flametongue, frostbrand, landslide, wind_strikes, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:42.039 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/150: 35% maelstrom flametongue, frostbrand, landslide, wind_strikes, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:43.146 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/150: 57% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:44.253 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/150: 41% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:45.358 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/150: 24% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:46.464 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:47.568 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:48.673 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, landslide, wind_strikes, lightning_crash, crashing_lightning(2), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:49.778 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, crashing_lightning(2), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:50.885 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/150: 59% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, crashing_lightning(2), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:51.991 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/150: 35% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(6), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:53.096 filler W crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/150: 25% maelstrom flametongue, frostbrand, landslide, unleash_doom, stormlash, lightning_crash, crashing_lightning(6), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:54.201 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/150: 15% maelstrom flametongue, frostbrand, landslide, unleash_doom, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:55.308 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/150: 35% maelstrom flametongue, frostbrand, landslide, unleash_doom, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:56.414 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/150: 15% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:57.520 filler X flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/150: 5% maelstrom flametongue, frostbrand, landslide, wind_strikes, lightning_crash, crashing_lightning, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:58.627 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/150: 8% maelstrom flametongue, frostbrand, landslide, wind_strikes, lightning_crash, crashing_lightning, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:59.732 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/150: 31% maelstrom flametongue, frostbrand, landslide, wind_strikes, lightning_crash, crashing_lightning, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:00.838 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/150: 11% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, crashing_lightning(2), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:00.838 Waiting     0.800 sec 220000.0/220000: 100% mana | 16.0/150: 11% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, lightning_crash, crashing_lightning(2), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:01.638 filler W crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/150: 14% maelstrom flametongue, frostbrand, landslide, stormlash, lightning_crash, crashing_lightning(2), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:02.745 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 6.0/150: 4% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:04.069 Waiting     1.800 sec 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:05.869 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:06.974 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:08.081 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, landslide, wind_strikes, lightning_crash, crashing_lightning, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:09.186 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/150: 33% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, lightning_crash, crashing_lightning, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:10.292 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/150: 32% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(2), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:11.398 buffs N flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/150: 9% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(4), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:12.504 CDs H doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/150: 12% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(4), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:12.504 CDs I ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/150: 12% maelstrom flametongue, frostbrand, stormbringer, landslide, doom_winds, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(4), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:12.504 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/150: 12% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(4), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:13.610 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/150: 35% maelstrom ascendance, flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(5), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:14.716 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/150: 42% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(6), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:15.822 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/150: 52% maelstrom ascendance, flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(7), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:16.929 CDs E berserking Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/150: 72% maelstrom ascendance, flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(8), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:16.929 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/150: 72% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(8), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:17.891 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, crashing_lightning(8), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:18.853 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom berserking, ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, crashing_lightning(10), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:19.812 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, crashing_lightning(11), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:20.773 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 147.0/150: 98% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, crashing_lightning(12), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:21.735 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 132.0/150: 88% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:22.697 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom berserking, ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(2), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:23.659 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(3), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:24.620 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(4), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:25.583 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom berserking, ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(4), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:26.544 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 136.0/150: 91% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(6), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:27.506 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(7), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:28.612 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(7), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:29.794 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom flametongue, frostbrand, landslide, wind_strikes, lightning_crash, crashing_lightning(8), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:30.899 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 144.0/150: 96% maelstrom flametongue, frostbrand, landslide, lightning_crash, crashing_lightning(8), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:32.005 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, lightning_crash, crashing_lightning(8), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:33.111 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, lightning_crash, crashing_lightning(10), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:34.216 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(11), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:35.321 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(12), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:36.426 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 144.0/150: 96% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, lightning_crash, crashing_lightning(12), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:37.532 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/150: 79% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, crashing_lightning(12), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:38.635 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/150: 69% maelstrom flametongue, frostbrand, landslide, unleash_doom, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:39.739 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 138.0/150: 92% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:40.846 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/150: 82% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:41.952 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/150: 65% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:43.057 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 132.0/150: 88% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:44.161 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/150: 71% maelstrom ascendance, flametongue, frostbrand, landslide, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:45.265 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/150: 75% maelstrom ascendance, flametongue, frostbrand, landslide, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:46.370 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/150: 73% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, lightning_crash, crashing_lightning, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:46.370 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/150: 73% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, lightning_crash, crashing_lightning, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:47.476 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 129.0/150: 86% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, lightning_crash, crashing_lightning(2), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:48.582 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 144.0/150: 96% maelstrom ascendance, flametongue, frostbrand, landslide, wind_strikes, lightning_crash, crashing_lightning(3), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:49.687 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 146.0/150: 97% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(4), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:50.793 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/150: 81% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(4), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:51.897 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 132.0/150: 88% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(5), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:53.003 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/150: 75% maelstrom ascendance, flametongue, frostbrand, stormbringer, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(5), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:54.107 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/150: 75% maelstrom flametongue, frostbrand, unleash_doom, wind_strikes, crashing_lightning(6), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:55.211 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 147.0/150: 98% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, crashing_lightning(6), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:56.317 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, crashing_lightning(8), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:57.422 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 139.0/150: 93% maelstrom flametongue, frostbrand, landslide, wind_strikes, crashing_lightning(9), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:58.526 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/150: 79% maelstrom ascendance, flametongue, frostbrand, landslide, wind_strikes, crashing_lightning(10), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:59.633 buffs M frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/150: 72% maelstrom ascendance, flametongue, landslide, wind_strikes, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:00.739 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/150: 62% maelstrom ascendance, flametongue, frostbrand, landslide, wind_strikes, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:01.845 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 132.0/150: 88% maelstrom ascendance, flametongue, frostbrand, landslide, wind_strikes, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:02.951 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 137.0/150: 91% maelstrom ascendance, flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:04.056 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/150: 75% maelstrom ascendance, flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:05.162 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 146.0/150: 97% maelstrom ascendance, flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:06.267 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/150: 81% maelstrom ascendance, flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:07.374 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/150: 64% maelstrom ascendance, flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:08.480 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:09.586 CDs G feral_spirit Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, landslide, stormlash, lightning_crash, crashing_lightning, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:10.692 buffs K crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, landslide, stormlash, lightning_crash, crashing_lightning, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:11.797 buffs O frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/150: 79% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:12.903 CDs H doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/150: 76% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:12.903 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/150: 76% maelstrom flametongue, frostbrand, landslide, doom_winds, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:14.009 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, doom_winds, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:15.117 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, landslide, doom_winds, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:16.223 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, lightning_crash, crashing_lightning, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:17.329 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, lightning_crash, crashing_lightning, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:18.434 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, lightning_crash, crashing_lightning(2), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:19.540 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(3), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:20.645 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(4), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:21.752 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(5), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:22.856 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(6), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:23.963 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom ascendance, flametongue, frostbrand, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(6), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:25.068 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer, wind_strikes, lightning_crash, crashing_lightning(7), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:26.175 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, lightning_crash, crashing_lightning(7), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:27.281 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, crashing_lightning(8), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:28.388 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, crashing_lightning(9), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:29.492 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:30.598 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/150: 79% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:31.705 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, landslide, unleash_doom, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:31.705 buffs M frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, landslide, unleash_doom, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:32.810 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom flametongue, frostbrand, landslide, gathering_storms, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:33.916 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:35.021 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:36.128 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 144.0/150: 96% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:37.234 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/150: 83% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:38.337 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/150: 66% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, lightning_crash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:39.442 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/150: 43% maelstrom flametongue, frostbrand, landslide, stormlash, lightning_crash, crashing_lightning(2), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:40.546 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/150: 65% maelstrom flametongue, frostbrand, landslide, stormlash, lightning_crash, crashing_lightning(2), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:41.653 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/150: 49% maelstrom flametongue, frostbrand, landslide, lightning_crash, crashing_lightning(2), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:42.758 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/150: 45% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, lightning_crash, crashing_lightning(2), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:43.863 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/150: 35% maelstrom flametongue, frostbrand, landslide, wind_strikes, lightning_crash, crashing_lightning(3), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:44.967 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/150: 8% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, crashing_lightning(4), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:46.074 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/150: 31% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, crashing_lightning(4), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:47.180 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/150: 21% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, crashing_lightning(6), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:48.285 buffs M frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, landslide, wind_strikes, stormlash, crashing_lightning(7), concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:49.390 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, crashing_lightning(7), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:50.496 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/150: 3% maelstrom flametongue, frostbrand, landslide, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:51.601 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/150: 29% maelstrom flametongue, frostbrand, landslide, wind_strikes, gathering_storms, stormlash, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:52.705 buffs L flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/150: 15% maelstrom frostbrand, landslide, wind_strikes, stormlash, lightning_crash, crashing_lightning(2), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:53.811 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/150: 19% maelstrom flametongue, frostbrand, landslide, lightning_crash, crashing_lightning(2), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:54.916 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/150: 41% maelstrom flametongue, frostbrand, landslide, lightning_crash, crashing_lightning(2), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:56.022 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/150: 25% maelstrom flametongue, frostbrand, landslide, lightning_crash, crashing_lightning(2), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:57.129 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/150: 51% maelstrom flametongue, frostbrand, landslide, lightning_crash, crashing_lightning(2), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:58.234 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/150: 34% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, lightning_crash, crashing_lightning(2), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:59.339 filler W crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/150: 24% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, lightning_crash, crashing_lightning(4), fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
5:00.443 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, gathering_storms, lightning_crash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4728 4403 0
Agility 44332 38901 28018 (24626)
Stamina 81377 81377 45295
Intellect 7649 7324 0
Spirit 1 1 0
Health 4882620 4882620 0
Mana 220000 220000 0
Maelstrom 150 150 0
Spell Power 53198 46681 0
Crit 18.60% 18.60% 3439
Haste 36.17% 36.17% 13565
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 44332 38901 0
Mastery 60.58% 60.58% 8916
Armor 3282 3282 3282
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 939.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of the Skybreaker
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +871 Crit, +515 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Flesh-Raking Leggings
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Mastery }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }, gems: { +150 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Eye of the Twisting Nether
ilevel: 970, stats: { +3515 Sta, +2884 Haste, +1602 Mastery }, gems: { +200 Agi }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Specter of Betrayal
ilevel: 940, stats: { +2994 StrAgi }
Local Trinket2 Cradle of Anguish
ilevel: 930, stats: { +1320 Haste }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Agi }
Local Main Hand Doomhammer
ilevel: 951, weapon: { 8445 - 15685, 2.6 }, stats: { +1496 Agi, +2244 Sta, +435 Crit, +418 Mastery }, relics: { +67 ilevels, +67 ilevels, +67 ilevels }
Local Off Hand Fury of the Stonemother
ilevel: 951, weapon: { 8445 - 15685, 2.6 }, stats: { +1496 Agi, +2244 Sta, +435 Crit, +418 Mastery }

Talents

Level
15 Windsong (Enhancement Shaman) Hot Hand (Enhancement Shaman) Landslide (Enhancement Shaman)
30 Rainfall (Enhancement Shaman) Feral Lunge (Enhancement Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Lightning Shield (Enhancement Shaman) Ancestral Swiftness Hailstorm (Enhancement Shaman)
75 Tempest (Enhancement Shaman) Overcharge (Enhancement Shaman) Empowered Stormlash (Enhancement Shaman)
90 Crashing Storm (Enhancement Shaman) Fury of Air (Enhancement Shaman) Sundering (Enhancement Shaman)
100 Ascendance (Enhancement Shaman) Boulderfist (Enhancement Shaman) Earthen Spike (Enhancement Shaman)

Profile

shaman="T20 4pc"
spec=enhancement
level=110
race=troll
role=attack
position=back
talents=3133111
artifact=41:0:0:0:0:899:1:900:1:901:1:902:1:903:1:904:1:905:4:906:4:907:4:908:4:909:4:910:4:911:4:912:4:913:4:930:1:1351:1:1388:1:1593:4:1594:1:1595:1:1596:1:1687:1

# Default consumables
potion=prolonged_power
flask=seventh_demon
food=lavish_suramar_feast
augmentation=defiled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/lightning_shield

# Executed every time the actor is available.
actions=wind_shear
actions+=/variable,name=hailstormCheck,value=((talent.hailstorm.enabled&!buff.frostbrand.up)|!talent.hailstorm.enabled)
actions+=/variable,name=furyCheck80,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>80))
actions+=/variable,name=furyCheck70,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>70))
actions+=/variable,name=furyCheck45,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>45))
actions+=/variable,name=furyCheck25,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>25))
actions+=/variable,name=OCPool70,value=(!talent.overcharge.enabled|(talent.overcharge.enabled&maelstrom>70))
actions+=/variable,name=OCPool60,value=(!talent.overcharge.enabled|(talent.overcharge.enabled&maelstrom>60))
actions+=/variable,name=heartEquipped,value=(equipped.151819)
actions+=/variable,name=akainuEquipped,value=(equipped.137084)
actions+=/variable,name=akainuAS,value=(variable.akainuEquipped&buff.hot_hand.react&!buff.frostbrand.up)
actions+=/variable,name=LightningCrashNotUp,value=(!buff.lightning_crash.up&set_bonus.tier20_2pc)
actions+=/variable,name=alphaWolfCheck,value=((pet.frost_wolf.buff.alpha_wolf.remains<2&pet.fiery_wolf.buff.alpha_wolf.remains<2&pet.lightning_wolf.buff.alpha_wolf.remains<2)&feral_spirit.remains>4)
actions+=/auto_attack
actions+=/use_items
actions+=/call_action_list,name=opener
actions+=/windstrike,if=(variable.heartEquipped|set_bonus.tier19_2pc)&(!talent.earthen_spike.enabled|(cooldown.earthen_spike.remains>1&cooldown.doom_winds.remains>1)|debuff.earthen_spike.up)
actions+=/call_action_list,name=buffs
actions+=/call_action_list,name=CDs
actions+=/call_action_list,name=core
actions+=/call_action_list,name=filler

actions.CDs=bloodlust,if=target.health.pct<25|time>0.500
actions.CDs+=/berserking,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
actions.CDs+=/blood_fury,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
actions.CDs+=/potion,if=buff.ascendance.up|!talent.ascendance.enabled&feral_spirit.remains>5|target.time_to_die<=60
actions.CDs+=/feral_spirit
actions.CDs+=/doom_winds,if=debuff.earthen_spike.up&talent.earthen_spike.enabled|!talent.earthen_spike.enabled
actions.CDs+=/ascendance,if=buff.doom_winds.up

actions.buffs=rockbiter,if=talent.landslide.enabled&!buff.landslide.up
actions.buffs+=/fury_of_air,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
actions.buffs+=/crash_lightning,if=artifact.alpha_wolf.rank&prev_gcd.1.feral_spirit
actions.buffs+=/flametongue,if=!buff.flametongue.up
actions.buffs+=/frostbrand,if=talent.hailstorm.enabled&!buff.frostbrand.up&variable.furyCheck45
actions.buffs+=/flametongue,if=buff.flametongue.remains<6+gcd&cooldown.doom_winds.remains<gcd*2
actions.buffs+=/frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<6+gcd&cooldown.doom_winds.remains<gcd*2

actions.core=earthen_spike,if=variable.furyCheck25
actions.core+=/crash_lightning,if=!buff.crash_lightning.up&active_enemies>=2
actions.core+=/windsong
actions.core+=/crash_lightning,if=active_enemies>=8|(active_enemies>=6&talent.crashing_storm.enabled)
actions.core+=/windstrike
actions.core+=/stormstrike,if=buff.stormbringer.up&variable.furyCheck25
actions.core+=/crash_lightning,if=active_enemies>=4|(active_enemies>=2&talent.crashing_storm.enabled)
actions.core+=/lightning_bolt,if=talent.overcharge.enabled&variable.furyCheck45&maelstrom>=40
actions.core+=/stormstrike,if=(!talent.overcharge.enabled&variable.furyCheck45)|(talent.overcharge.enabled&variable.furyCheck80)
actions.core+=/frostbrand,if=variable.akainuAS
actions.core+=/lava_lash,if=buff.hot_hand.react&((variable.akainuEquipped&buff.frostbrand.up)|!variable.akainuEquipped)
actions.core+=/sundering,if=active_enemies>=3
actions.core+=/crash_lightning,if=active_enemies>=3|variable.LightningCrashNotUp|variable.alphaWolfCheck

actions.filler=rockbiter,if=maelstrom<120
actions.filler+=/flametongue,if=buff.flametongue.remains<4.8
actions.filler+=/rockbiter,if=maelstrom<=40
actions.filler+=/crash_lightning,if=(talent.crashing_storm.enabled|active_enemies>=2)&debuff.earthen_spike.up&maelstrom>=40&variable.OCPool60
actions.filler+=/frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<4.8&maelstrom>40
actions.filler+=/frostbrand,if=variable.akainuEquipped&!buff.frostbrand.up&maelstrom>=75
actions.filler+=/sundering
actions.filler+=/lava_lash,if=maelstrom>=50&variable.OCPool70&variable.furyCheck80
actions.filler+=/rockbiter
actions.filler+=/crash_lightning,if=(maelstrom>=65|talent.crashing_storm.enabled|active_enemies>=2)&variable.OCPool60&variable.furyCheck45
actions.filler+=/flametongue

actions.opener=rockbiter,if=maelstrom<15&time<2

head=helmet_of_the_skybreaker,id=147178,bonus_id=1512/3563
neck=string_of_extracted_incisors,id=147013,bonus_id=1512/3563,enchant_id=5439
shoulders=pauldrons_of_the_skybreaker,id=147180,bonus_id=1512/3563
back=drape_of_the_skybreaker,id=147176,bonus_id=1512/3563,enchant_id=5435
chest=harness_of_the_skybreaker,id=147175,bonus_id=1512/3563
wrists=painsinged_armguards,id=147057,bonus_id=1512/3563
hands=smoldering_heart,id=151819,bonus_id=3570
waist=waistguard_of_interminable_unity,id=147056,bonus_id=1512/3563
legs=fleshraking_leggings,id=147051,bonus_id=1512/3563
feet=starstalker_treads,id=147046,bonus_id=1522/3563,gem_id=130222
finger1=eye_of_the_twisting_nether,id=137050,bonus_id=3570,gem_id=130247,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,bonus_id=1512/3563,enchant=200haste
trinket1=specter_of_betrayal,id=151190,bonus_id=1522/3563
trinket2=cradle_of_anguish,id=147010,bonus_id=1512/3563
main_hand=doomhammer,id=128819,bonus_id=745,gem_id=147088/147100/147115,relic_id=1512:3563/1512:3563/1512:3563
off_hand=fury_of_the_stonemother,id=128873,gem_id=0/0/0/0,relic_id=0/0

# Gear Summary
# gear_ilvl=938.88
# gear_agility=28018
# gear_stamina=45295
# gear_crit_rating=3439
# gear_haste_rating=13565
# gear_mastery_rating=8916
# gear_versatility_rating=2624
# gear_armor=3282
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

baseline : 1266175 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1266174.7 1266174.7 2705.5 / 0.214% 267797.8 / 21.2% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.49% 60.6 99.9% 100%
Talents
  • 15: Landslide (Enhancement Shaman)
  • 30: Rainfall (Enhancement Shaman)
  • 45: Voodoo Totem
  • 60: Hailstorm (Enhancement Shaman)
  • 75: Tempest (Enhancement Shaman)
  • 90: Crashing Storm (Enhancement Shaman)
  • 100: Ascendance (Enhancement Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
baseline 1266175
Crash Lightning 8478 (13602) 0.7% (1.1%) 11.4 24.95sec 360010 342542 Direct 11.4 189274 378968 224394 18.5% 0.0%  

Stats details: crash_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.43 11.43 0.00 0.00 1.0511 0.0000 2564987.00 2564987.00 0.00 342542.14 342542.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.31 81.48% 189273.62 179239 202409 189588.43 181928 202409 1762749 1762749 0.00
crit 2.12 18.52% 378968.08 358479 404819 325309.97 0 404819 802238 802238 0.00
 
 

Action details: crash_lightning

Static Values
  • id:187874
  • school:nature
  • resource:maelstrom
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:artifact.alpha_wolf.rank&prev_gcd.1.feral_spirit
Spelldata
  • id:187874
  • name:Crash Lightning
  • school:nature
  • tooltip:Stormstrike and Lava Lash deal an additional $195592sw1 damage to all targets in front of you.
  • description:Electrocutes all enemies in front of you, dealing $sw1 Nature damage. Hitting 2 or more targets enhances your weapons for {$187878d=10 seconds}, causing Stormstrike and Lava Lash to also deal $195592sw1 Nature damage to all targets in front of you.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.50
 
    Crashing Storm 5124 0.4% 79.2 3.39sec 19572 0 Direct 79.2 16506 33027 19573 18.6% 0.0%  

Stats details: crashing_storm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.19 79.19 0.00 0.00 0.0000 0.0000 1549971.72 1549971.72 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.50 81.44% 16505.71 14519 18094 16535.89 15763 17943 1064550 1064550 0.00
crit 14.70 18.56% 33027.48 29037 36187 33073.27 0 36187 485422 485422 0.00
 
 

Action details: crashing_storm

Static Values
  • id:210801
  • school:nature
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210801
  • name:Crashing Storm
  • school:nature
  • tooltip:
  • description:{$@spelldesc192246=Crash Lightning also electrifies the ground, leaving an electrical field behind which damages enemies within it for ${7*{$210801s1=1}} Nature damage over {$210797d=6 seconds}. }
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.160000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Dread Torrent 39287 3.1% 52.9 10.60sec 222802 0 Direct 52.9 187690 375373 222803 18.7% 0.0%  

Stats details: dread_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.89 52.89 0.00 0.00 0.0000 0.0000 11782914.17 11782914.17 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.99 81.29% 187690.15 182405 187918 187685.98 187019 187918 8069020 8069020 0.00
crit 9.89 18.71% 375372.81 364809 375836 375373.62 370323 375836 3713894 3713894 0.00
 
 

Action details: dread_torrent

Static Values
  • id:246464
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246464
  • name:Dread Torrent
  • school:shadow
  • tooltip:
  • description:{$@spelldesc246461=Create a Dread Reflection at your location for {$d=60 seconds} and cause each of your Dread Reflections to unleash a torrent of magic that deals ${{$246464s1=39731 to 43913}*4} Shadow damage over {$246463d=3 seconds}, split evenly among nearby enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:140074.50
  • base_dd_max:154819.18
 
Flametongue 15070 (65999) 1.2% (5.2%) 19.8 15.44sec 996327 939785 Direct 19.8 192229 384628 228175 18.7% 0.0%  

Stats details: flametongue

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.80 19.80 0.00 0.00 1.0602 0.0000 4517772.21 4517772.21 0.00 939785.22 939785.22
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.10 81.32% 192229.40 179999 210826 192312.36 186069 201769 3094961 3094961 0.00
crit 3.70 18.68% 384627.96 359999 421651 376936.89 0 421651 1422812 1422812 0.00
 
 

Action details: flametongue

Static Values
  • id:193796
  • school:fire
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!buff.flametongue.up
Spelldata
  • id:193796
  • name:Flametongue
  • school:fire
  • tooltip:
  • description:Scorches your target, dealing {$s2=1} Fire damage, and enhances your weapons with fire for {$194084d=16 seconds}, causing each weapon attack to deal up to ${$<coeff>*$AP} Fire damage, based on weapon speed.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Flametongue Attack 50929 4.0% 903.9 0.60sec 16826 0 Direct 903.9 14187 28376 16826 18.6% 0.0%  

Stats details: flametongue_attack

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 903.93 903.93 0.00 0.00 0.0000 0.0000 15209259.40 15209259.40 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 735.83 81.40% 14187.42 12111 15550 14193.55 13864 14617 10439544 10439544 0.00
crit 168.09 18.60% 28375.52 24223 31099 28387.16 27714 29246 4769715 4769715 0.00
 
 

Action details: flametongue_attack

Static Values
  • id:10444
  • school:fire
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:{$@spelldesc193796=Scorches your target, dealing {$s2=1} Fire damage, and enhances your weapons with fire for {$194084d=16 seconds}, causing each weapon attack to deal up to ${$<coeff>*$AP} Fire damage, based on weapon speed.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Frostbrand 8877 (120514) 0.7% (9.5%) 18.9 16.19sec 1906781 1797387 Direct 18.9 118671 237496 140882 18.7% 0.0%  

Stats details: frostbrand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.89 18.89 86.86 0.00 1.0609 3.3229 2660878.49 2660878.49 0.00 116677.85 1797387.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.36 81.31% 118671.18 111001 130010 118728.89 114880 124180 1822449 1822449 0.00
crit 3.53 18.69% 237496.21 222001 260020 232082.32 0 260020 838430 838430 0.00
 
 

Action details: frostbrand

Static Values
  • id:196834
  • school:frost
  • resource:maelstrom
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.hailstorm.enabled&!buff.frostbrand.up&variable.furyCheck45
Spelldata
  • id:196834
  • name:Frostbrand
  • school:frost
  • tooltip:Melee attacks reduce target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
  • description:Chills your target, dealing {$s1=1} Frost damage and reducing the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}, and enhances your weapons with frost for {$d=16 seconds}, causing each weapon attack to reduce the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.925000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.00
  • base_tick_time:5.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Hailstorm 111637 8.8% 892.6 0.60sec 37366 0 Direct 892.6 31500 63008 37366 18.6% 0.0%  

Stats details: hailstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 892.61 892.61 0.00 0.00 0.0000 0.0000 33353372.07 33353372.07 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 726.41 81.38% 31500.00 28255 33735 31510.10 30991 32271 22882017 22882017 0.00
crit 166.19 18.62% 63008.09 56510 67470 63028.57 61977 64563 10471355 10471355 0.00
 
 

Action details: hailstorm

Static Values
  • id:210854
  • school:frost
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210854
  • name:Hailstorm
  • school:frost
  • tooltip:
  • description:{$@spelldesc210853=Frostbrand now also enhances your weapon's damage, causing each of your weapon attacks to also deal $210854sw1 Frost damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.30
 
Lava Lash 114099 (127263) 9.1% (10.1%) 45.4 6.28sec 841547 792840 Direct 45.4 636823 1273354 754378 18.5% 0.0%  

Stats details: lava_lash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.42 45.42 0.00 0.00 1.0614 0.0000 34264403.75 34264403.75 0.00 792840.06 792840.06
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.03 81.53% 636822.58 445991 1478679 642142.48 555248 852391 23580861 23580861 0.00
crit 8.39 18.47% 1273353.50 909823 2957357 1282154.90 0 2375121 10683543 10683543 0.00
 
 

Action details: lava_lash

Static Values
  • id:60103
  • school:fire
  • resource:maelstrom
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.hot_hand.react&((variable.akainuEquipped&buff.frostbrand.up)|!variable.akainuEquipped)
Spelldata
  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing $sw1 Fire damage.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:7.81
 
    Doom Vortex (_ll) 13164 1.0% 54.0 4.94sec 73369 0 Direct 54.0 61832 123627 73366 18.7% 0.0%  

Stats details: doom_vortex_ll

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.95 53.95 0.00 0.00 0.0000 0.0000 3958415.51 3958415.51 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 43.88 81.33% 61832.11 53634 67845 61867.53 59327 65478 2713222 2713222 0.00
crit 10.07 18.67% 123626.54 107269 135691 123576.15 0 135691 1245194 1245194 0.00
 
 

Action details: doom_vortex_ll

Static Values
  • id:199116
  • school:fire
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:199116
  • name:Doom Vortex
  • school:fire
  • tooltip:
  • description:{$@spelldesc199107=Lava Lash{$?s210727=false}[ and Lightning Bolt have][ has] a chance to cause |cFFFFCC99Doomhammer|r to release a fiery tornado at your target's location, dealing ${3*{$199116s1=1}} Fire damage over {$199121d=3 seconds} to enemies within $199116A1 yards.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.600000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
main_hand 18693 1.5% 131.9 2.27sec 42657 27071 Direct 131.9 42789 85562 42654 18.6% 18.9%  

Stats details: main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 131.87 131.87 0.00 0.00 1.5757 0.0000 5625118.96 8269457.70 31.98 27070.91 27070.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 82.49 62.56% 42789.37 38433 46041 42804.39 41931 43996 3529714 5189014 31.98
crit 24.49 18.57% 85562.39 76867 92082 85591.65 82948 89794 2095405 3080443 31.98
miss 24.89 18.87% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Mark of the Hidden Satyr 20941 1.7% 20.5 14.59sec 305211 0 Direct 20.5 257305 514179 305228 18.7% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.55 20.55 0.00 0.00 0.0000 0.0000 6271926.87 6271926.87 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.72 81.35% 257305.13 223468 282681 257372.25 245374 271721 4301323 4301323 0.00
crit 3.83 18.65% 514179.15 446936 565361 502177.33 0 565361 1970604 1970604 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
offhand 9306 0.7% 131.3 2.27sec 21336 13489 Direct 131.3 21409 42828 21335 18.7% 19.0%  

Stats details: offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 131.27 131.27 0.00 0.00 1.5817 0.0000 2800781.62 4117414.27 31.98 13489.42 13489.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 81.75 62.27% 21408.81 18933 23021 21417.10 20991 22071 1750112 2572831 31.98
crit 24.53 18.69% 42827.58 38433 46041 42847.67 41759 44483 1050669 1544583 31.98
miss 24.99 19.04% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: offhand

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Rockbiter 100106 8.0% 57.6 5.15sec 522251 488132 Direct 57.6 440315 880989 522249 18.6% 0.0%  

Stats details: rockbiter

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.62 57.62 0.00 0.00 1.0699 0.0000 30090409.14 30090409.14 0.00 488132.00 488132.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 46.90 81.41% 440314.58 406397 483136 440545.75 429212 455439 20652136 20652136 0.00
crit 10.71 18.59% 880988.77 824986 966273 881408.71 837361 949746 9438273 9438273 0.00
 
 

Action details: rockbiter

Static Values
  • id:193786
  • school:nature
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.landslide.enabled&!buff.landslide.up
Spelldata
  • id:193786
  • name:Rockbiter
  • school:nature
  • tooltip:
  • description:Assaults your target with earthen power, dealing {$s1=0} Nature damage. |cFFFFFFFFGenerates {$s2=25} Maelstrom.|r
 
Stormlash 38165 3.0% 699.2 1.08sec 16336 0 Direct 699.2 16337 0 16337 0.0% 0.0%  

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 699.20 699.20 0.00 0.00 0.0000 0.0000 11422301.95 11422301.95 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 699.20 100.00% 16336.80 2703 95902 16335.81 14128 18576 11422302 11422302 0.00
 
 

Action details: stormlash

Static Values
  • id:213307
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:213307
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:{$@spelldesc195255=While your weapons are enhanced, your attacks have a chance to grant Stormlash to up to {$?s210731=false}[${$m1+$210731m1}][{$s1=2}] party or raid members for {$195222d=8 seconds}, causing attacks and spellcasts to deal additional Nature damage.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:2.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:6042.93
  • base_dd_max:6042.93
 
Stormstrike 0 (231001) 0.0% (18.4%) 73.4 3.76sec 945574 876429

Stats details: stormstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.37 0.00 0.00 0.00 1.0789 0.0000 0.00 0.00 0.00 876429.49 876429.49
 
 

Action details: stormstrike

Static Values
  • id:17364
  • school:physical
  • resource:maelstrom
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.stormbringer.up&variable.furyCheck25
Spelldata
  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of ${$32175sw1+$32176sw1} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
    Stormstrike (_mh) 154043 12.2% 91.7 3.76sec 504452 0 Direct 91.7 332567 809535 504462 36.0% 0.0%  

Stats details: stormstrike_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.70 91.70 0.00 0.00 0.0000 0.0000 46256860.43 68001966.41 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.65 63.96% 332566.75 131204 520883 333190.81 285601 382369 19502337 28670283 31.98
crit 33.05 36.04% 809535.17 273338 1041766 810352.27 599447 907588 26754523 39331683 31.98
 
 

Action details: stormstrike_mh

Static Values
  • id:32175
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of ${$32175sw1+$32176sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:7.50
 
    Stormstrike Off-Hand 76958 6.1% 91.7 3.76sec 252100 0 Direct 91.7 166418 404328 252113 36.0% 0.0%  

Stats details: stormstrike_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.70 91.70 0.00 0.00 0.0000 0.0000 23116915.57 33984055.59 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.67 63.98% 166417.83 65602 260441 166740.56 143529 191731 9762683 14352069 31.98
crit 33.03 36.02% 404328.42 136669 520883 404847.45 331168 459629 13354232 19631987 31.98
 
 

Action details: stormstrike_offhand

Static Values
  • id:32176
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of ${$32175sw1+$32176sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:7.50
 
Unleash Lava 45729 3.6% 127.6 3.17sec 106540 0 Direct 126.1 90886 181788 107839 18.6% 0.0%  

Stats details: unleash_lava

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 127.60 126.07 0.00 0.00 0.0000 0.0000 13594747.76 13594747.76 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 102.56 81.35% 90885.92 78663 99506 90919.86 87919 94898 9321133 9321133 0.00
crit 23.51 18.65% 181787.77 157326 199012 181864.43 172837 194314 4273615 4273615 0.00
 
 

Action details: unleash_lava

Static Values
  • id:199053
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:1.2000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:199053
  • name:Unleash Lava
  • school:fire
  • tooltip:
  • description:{$@spelldesc198736=Stormstrike has a chance to unleash the power of |cFFFFCC99Doomhammer|r, causing your special attacks to heave molten lava or lightning spikes at your target for {$199053s1=1} Fire or Nature damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.800000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Unleash Lightning 45641 3.6% 127.4 3.18sec 106537 0 Direct 125.9 90878 181782 107817 18.6% 0.0%  

Stats details: unleash_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 127.38 125.87 0.00 0.00 0.0000 0.0000 13570470.76 13570470.76 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 102.41 81.37% 90877.52 78663 99506 90913.76 87757 94617 9306990 9306990 0.00
crit 23.45 18.63% 181781.68 157326 199012 181877.05 172006 194344 4263481 4263481 0.00
 
 

Action details: unleash_lightning

Static Values
  • id:199054
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:1.2000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:199054
  • name:Unleash Lightning
  • school:nature
  • tooltip:
  • description:{$@spelldesc198736=Stormstrike has a chance to unleash the power of |cFFFFCC99Doomhammer|r, causing your special attacks to heave molten lava or lightning spikes at your target for {$199053s1=1} Fire or Nature damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.800000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Windlash (wind_lash) 13958 1.1% 55.1 4.93sec 74913 57296 Direct 55.1 63211 126487 74911 18.5% 0.0%  

Stats details: wind_lash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.10 55.10 0.00 0.00 1.3075 0.0000 4127358.85 4127358.85 0.00 57295.78 57295.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.91 81.51% 63210.90 55666 67685 63255.94 60987 66540 2838572 2838572 0.00
crit 10.19 18.49% 126486.58 113001 135370 126554.39 118377 134028 1288787 1288787 0.00
 
 

Action details: wind_lash

Static Values
  • id:114089
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114089
  • name:Windlash
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals $sw1 Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Windlash Off-Hand (wind_lash_offhand) 6999 0.5% 55.2 4.93sec 37511 28722 Direct 55.2 31611 63197 37509 18.7% 0.0%  

Stats details: wind_lash_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.17 55.17 0.00 0.00 1.3060 0.0000 2069475.56 2069475.56 0.00 28721.57 28721.57
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.87 81.32% 31611.34 27833 33842 31632.88 30370 33337 1418272 1418272 0.00
crit 10.30 18.68% 63196.67 56501 67685 63234.24 59336 67685 651204 651204 0.00
 
 

Action details: wind_lash_offhand

Static Values
  • id:114093
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114093
  • name:Windlash Off-Hand
  • school:physical
  • tooltip:
  • description:A massive gust of air that deals $sw1 Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Windfury Attack 69952 5.5% 179.6 3.39sec 116143 0 Direct 179.6 97878 195739 116135 18.7% 0.0%  

Stats details: windfury_attack

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 179.56 179.56 0.00 0.00 0.0000 0.0000 20854876.89 30658644.45 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 146.06 81.34% 97878.39 55855 200065 98145.38 82751 126009 14297127 21018131 31.98
crit 33.50 18.66% 195739.23 111710 400130 196293.85 134278 280340 6557750 9640514 31.98
 
 

Action details: windfury_attack

Static Values
  • id:25504
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Each of your main hand attacks has a {$33757h=20}% chance to trigger two extra attacks, dealing $25504sw2 Physical damage each.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Windfury Attack (_oh) 14150 1.1% 38.1 14.86sec 110908 0 Direct 38.1 93588 187213 110910 18.5% 0.0%  

Stats details: windfury_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.06 38.06 0.00 0.00 0.0000 0.0000 4220642.86 6204744.80 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.02 81.50% 93588.12 83783 100032 93625.02 90118 97866 2902671 4267201 31.98
crit 7.04 18.50% 187212.93 167566 200065 187254.89 0 200065 1317972 1937544 31.96
 
 

Action details: windfury_attack_oh

Static Values
  • id:33750
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:33750
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:$@spelldesc8232
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Windstrike 0 (244530) 0.0% (19.1%) 54.8 4.96sec 1316384 1342168

Stats details: windstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 54.78 0.00 0.00 0.00 0.9808 0.0000 0.00 0.00 0.00 1342167.72 1342167.72
 
 

Action details: windstrike

Static Values
  • id:115356
  • school:physical
  • resource:maelstrom
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(variable.heartEquipped|set_bonus.tier19_2pc)&(!talent.earthen_spike.enabled|(cooldown.earthen_spike.remains>1&cooldown.doom_winds.remains>1)|debuff.earthen_spike.up)
Spelldata
  • id:115356
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:Hurl a staggering blast of wind at an enemy, dealing a total of ${$115357sw1+$115360sw1} Physical damage, bypassing armor.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
    Windstrike (_mh) 162982 12.7% 68.4 4.96sec 702419 0 Direct 68.4 484537 1159108 702567 32.3% 0.0%  

Stats details: windstrike_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 68.41 68.40 0.00 0.00 0.0000 0.0000 48055655.83 48055655.83 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 46.29 67.68% 484536.80 190032 765747 486194.56 405359 565015 22431167 22431167 0.00
crit 22.11 32.32% 1159107.91 380063 1531494 1161825.34 759198 1330234 25624489 25624489 0.00
 
 

Action details: windstrike_mh

Static Values
  • id:115357
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115357
  • name:Windstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of ${$115357sw1+$115360sw1} Physical damage, bypassing armor.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:7.50
 
    Windstrike Off-Hand 81548 6.4% 68.4 4.96sec 351607 0 Direct 68.4 242025 580296 351675 32.4% 0.0%  

Stats details: windstrike_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 68.41 68.40 0.00 0.00 0.0000 0.0000 24054989.00 24054989.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 46.23 67.59% 242024.69 95016 382874 242878.38 194579 298137 11188422 11188422 0.00
crit 22.17 32.41% 580295.96 190032 765747 582017.98 469006 680981 12866567 12866567 0.00
 
 

Action details: windstrike_offhand

Static Values
  • id:115360
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:30.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115360
  • name:Windstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc115356=Hurl a staggering blast of wind at an enemy, dealing a total of ${$115357sw1+$115360sw1} Physical damage, bypassing armor.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:7.50
 
pet - frost_wolf 315959 / 18831
Frozen Bite 144367 0.7% 8.1 30.18sec 318454 0 Direct 8.1 268973 537304 318453 18.4% 0.0%  

Stats details: frozen_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.11 8.11 0.00 0.00 0.0000 0.0000 2582387.42 2582387.42 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.61 81.56% 268973.25 236633 294910 267965.11 0 294910 1778897 1778897 0.00
crit 1.50 18.44% 537304.39 473265 589819 402626.11 0 589819 803491 803491 0.00
 
 

Action details: frozen_bite

Static Values
  • id:224126
  • school:frost
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224126
  • name:Frozen Bite
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Bite the target, causing {$s1=1} Frost damage and slowing the target's movement speed by {$s2=50}% for {$d=4 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
melee 102575 0.5% 46.9 4.62sec 38904 46189 Direct 46.9 32772 65531 38904 18.7% 0.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.86 46.86 0.00 0.00 0.8423 0.0000 1822889.97 2679820.92 31.98 46188.87 46188.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.08 81.28% 32771.68 28640 35693 32749.87 30358 35693 1248063 1834771 31.98
crit 8.77 18.72% 65530.86 57279 71386 64975.69 0 71386 574827 845050 31.72
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Snowstorm 69016 0.3% 14.3 15.03sec 85576 0 Direct 14.3 72081 144129 85585 18.7% 0.0%  

Stats details: snowstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.31 14.31 0.00 0.00 0.0000 0.0000 1224908.71 1224908.71 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.63 81.27% 72081.43 63102 78642 71659.13 0 78642 838483 838483 0.00
crit 2.68 18.73% 144129.02 126203 157284 127941.30 0 157284 386426 386426 0.00
 
 

Action details: snowstorm

Static Values
  • id:198483
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198483
  • name:Snowstorm
  • school:frost
  • tooltip:
  • description:Deals {$s1=0} Frost damage to all targets within $A1 yards.
 
pet - fiery_wolf 406140 / 24048
Fiery Jaws 230029 1.1% 8.2 30.28sec 496679 0 Direct 8.2 179495 358681 212664 18.5% 0.0%  
Periodic 32.5 71906 0 71906 0.0% 0.0% 10.8%

Stats details: fiery_jaws

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.23 8.23 32.50 32.50 0.0000 1.0000 4086653.11 4086653.11 0.00 125754.78 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.70 81.48% 179494.62 157756 196607 178999.77 0 196607 1203444 1203444 0.00
crit 1.52 18.52% 358681.47 315511 393214 271685.49 0 393214 546425 546425 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.5 100.00% 71906.19 63103 78644 71764.09 0 78644 2336784 2336784 0.00
 
 

Action details: fiery_jaws

Static Values
  • id:224125
  • school:fire
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224125
  • name:Fiery Jaws
  • school:fire
  • tooltip:Suffering {$s2=1} Fire damage every $t sec.
  • description:Bite the target for {$s1=1} Fire damage, causing an additional $o2 Fire damage over {$d=4 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.400000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Fire Nova 70759 0.3% 14.6 15.01sec 85618 0 Direct 14.6 72197 144507 85624 18.6% 0.0%  

Stats details: fire_nova

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.61 14.61 0.00 0.00 0.0000 0.0000 1250580.06 1250580.06 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.90 81.44% 72197.48 63102 78642 71845.82 0 78642 858850 858850 0.00
crit 2.71 18.56% 144506.99 126203 157284 128389.12 0 157284 391730 391730 0.00
 
 

Action details: fire_nova

Static Values
  • id:198480
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198480
  • name:Fire Nova
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to all targets within $A1 yards.
 
melee 105351 0.5% 47.9 4.59sec 38873 46453 Direct 47.9 32806 65651 38871 18.5% 0.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.87 47.87 0.00 0.00 0.8368 0.0000 1860829.30 2735595.33 31.98 46453.38 46453.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.03 81.53% 32806.33 28640 35693 32772.03 30221 35693 1280388 1882291 31.98
crit 8.84 18.47% 65651.13 57279 71386 65279.00 0 71386 580442 853304 31.83
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lightning_wolf 248829 / 14938
melee 146804 0.7% 48.6 4.54sec 54109 64326 Direct 48.6 45599 91221 54107 18.7% 0.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.57 48.57 0.00 0.00 0.8412 0.0000 2628302.34 3863853.40 31.98 64326.15 64326.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.51 81.35% 45599.17 28640 53539 45474.55 0 50041 1801790 2648802 31.94
crit 9.06 18.65% 91221.33 57279 107079 90461.64 0 107079 826512 1215051 31.70
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Thunder Bite 102025 0.5% 14.7 14.99sec 123654 0 Direct 14.7 104257 208827 123668 18.6% 0.0%  

Stats details: thunder_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.73 14.73 0.00 0.00 0.0000 0.0000 1821418.49 1821418.49 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.00 81.45% 104256.74 63102 117963 103550.20 0 117963 1250750 1250750 0.00
crit 2.73 18.55% 208827.43 126203 235926 182263.54 0 235926 570669 570669 0.00
 
 

Action details: thunder_bite

Static Values
  • id:198485
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198485
  • name:Thunder Bite
  • school:nature
  • tooltip:
  • description:Deals {$s1=0} Nature damage, jumping to up to $x targets.
 
Simple Action Stats Execute Interval
baseline
Ascendance 2.0 185.06sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.04 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114051
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.doom_winds.up
Spelldata
  • id:114051
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a $114089r yard range. Stormstrike is empowered and has a $114089r yard range.
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, reducing the cooldown and cost of Stormstrike by {$s4=80}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$s1=30} yd range.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:baseline
  • harmful:false
  • if_expr:
 
Berserking 2.0 189.96sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.03 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ascendance.up|(feral_spirit.remains>5)|level<100
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
Doom Winds 5.3 61.66sec

Stats details: doom_winds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.32 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: doom_winds

Static Values
  • id:204945
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:debuff.earthen_spike.up&talent.earthen_spike.enabled|!talent.earthen_spike.enabled
Spelldata
  • id:204945
  • name:Doom Winds
  • school:physical
  • tooltip:Chance to proc Windfury weapon on auto attacks increased by 100%. Windfury damage increased by {$s2=200}%.
  • description:Unleashes the inner power of the |cFFFFCC99Doomhammer|r, causing all auto attacks to trigger Windfury, and increasing damage dealt by Windfury by {$s2=200}% for {$d=6 seconds}.
 
Feral Spirit 3.0 121.17sec

Stats details: feral_spirit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 0.00 0.00 0.00 1.0191 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: feral_spirit

Static Values
  • id:51533
  • school:nature
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects$?a231723[ and grant you {$190185s1=5} Maelstrom each time they attack][].
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:baseline
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:baseline
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
pet - lightning_wolf
Crackling Surge 8.4 29.93sec

Stats details: crackling_surge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.42 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: crackling_surge

Static Values
  • id:224127
  • school:nature
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224127
  • name:Crackling Surge
  • school:nature
  • tooltip:Damage dealt increased by {$s1=50}%.
  • description:The Doom Wolf surges with electric energy, increasing all damage dealt by {$s1=50}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 6.4 0.1 47.6sec 46.5sec 27.75% 87.82% 0.1(0.1) 6.1

Buff details

  • buff initial source:baseline
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:27.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114051
  • name:Ascendance
  • tooltip:Transformed into a powerful Air ascendant. Auto attacks have a $114089r yard range. Stormstrike is empowered and has a $114089r yard range.
  • description:Transform into an Air Ascendant for {$114051d=15 seconds}, reducing the cooldown and cost of Stormstrike by {$s4=80}%, and transforming your auto attack and Stormstrike into Wind attacks which bypass armor and have a {$s1=30} yd range.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Berserking 2.0 0.0 190.0sec 190.0sec 6.82% 11.75% 0.0(0.0) 2.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.61% 13.61% 0.0(0.0) 1.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Chill of the Twisting Nether 1.1 926.1 157.4sec 0.3sec 99.27% 99.34% 926.1(926.1) 0.1

Buff details

  • buff initial source:baseline
  • cooldown name:buff_chill_of_the_twisting_nether
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02

Stack Uptimes

  • chill_of_the_twisting_nether_1:99.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:207998
  • name:Chill of the Twisting Nether
  • tooltip:All damage done increased by ${{$s1=15}/10}.1%.
  • description:{$@spelldesc207994=Damaging enemies with your Fire, Frost, or Nature abilities increases all damage you deal by ${{$207995s1=15}/10}.1% for {$207995d=8 seconds}. Each element adds a separate application.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.7sec 25.2sec 32.04% 32.04% 3.1(3.1) 7.9

Buff details

  • buff initial source:baseline
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Doom Winds 5.3 0.0 61.7sec 61.7sec 10.49% 19.33% 0.0(0.0) 5.2

Buff details

  • buff initial source:baseline
  • cooldown name:buff_doom_winds
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • doom_winds_1:10.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:204945
  • name:Doom Winds
  • tooltip:Chance to proc Windfury weapon on auto attacks increased by 100%. Windfury damage increased by {$s2=200}%.
  • description:Unleashes the inner power of the |cFFFFCC99Doomhammer|r, causing all auto attacks to trigger Windfury, and increasing damage dealt by Windfury by {$s2=200}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:60.00
  • default_chance:0.00%
Fire of the Twisting Nether 1.0 1134.4 156.4sec 0.3sec 99.62% 99.69% 1134.4(1134.4) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_fire_of_the_twisting_nether
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02

Stack Uptimes

  • fire_of_the_twisting_nether_1:99.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:207995
  • name:Fire of the Twisting Nether
  • tooltip:All damage done increased by ${{$s1=15}/10}.1%.
  • description:{$@spelldesc207994=Damaging enemies with your Fire, Frost, or Nature abilities increases all damage you deal by ${{$207995s1=15}/10}.1% for {$207995d=8 seconds}. Each element adds a separate application.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Flametongue 4.8 15.0 62.6sec 15.5sec 98.32% 98.40% 30.1(30.1) 3.8

Buff details

  • buff initial source:baseline
  • cooldown name:buff_flametongue
  • max_stacks:1
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • flametongue_1:98.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194084
  • name:Flametongue
  • tooltip:Each of your weapon attacks causes up to ${$<coeff>*$AP} additional Fire damage.
  • description:{$@spelldesc193796=Scorches your target, dealing {$s2=1} Fire damage, and enhances your weapons with fire for {$194084d=16 seconds}, causing each weapon attack to deal up to ${$<coeff>*$AP} Fire damage, based on weapon speed.}
  • max_stacks:0
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
Frostbrand 7.0 11.8 42.7sec 16.2sec 96.77% 97.04% 46.0(46.0) 6.1

Buff details

  • buff initial source:baseline
  • cooldown name:buff_frostbrand
  • max_stacks:1
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • frostbrand_1:96.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196834
  • name:Frostbrand
  • tooltip:Melee attacks reduce target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
  • description:Chills your target, dealing {$s1=1} Frost damage and reducing the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}, and enhances your weapons with frost for {$d=16 seconds}, causing each weapon attack to reduce the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
  • max_stacks:0
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
Gathering Storms 9.6 1.8 30.3sec 25.2sec 10.54% 7.53% 1.8(1.8) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_gathering_storms
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • gathering_storms_1:10.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:198300
  • name:Gathering Storms
  • tooltip:Damage of Stormstrike increased by $w1%.
  • description:{$@spelldesc198299=Each target hit by Crash Lightning increases damage dealt by your next Stormstrike within {$198300d=12 seconds} by {$s1=2}%.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Landslide 7.8 49.8 38.0sec 5.2sec 96.05% 90.04% 49.8(49.8) 6.9

Buff details

  • buff initial source:baseline
  • cooldown name:buff_landslide
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • landslide_1:96.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202004
  • name:Landslide
  • tooltip:Agility increased by {$s1=8}%.
  • description:{$@spelldesc197992=$?s201897[Boulderfist][Rockbiter] enhances your weapon, increasing your Agility by {$202004s1=8}% for {$202004d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 104.4sec 0.0sec 40.12% 40.12% 0.0(0.0) 2.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:40.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Shock of the Twisting Nether 2.2 204.4 116.7sec 1.4sec 99.18% 99.03% 204.4(204.4) 1.2

Buff details

  • buff initial source:baseline
  • cooldown name:buff_shock_of_the_twisting_nether
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.02

Stack Uptimes

  • shock_of_the_twisting_nether_1:99.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:207999
  • name:Shock of the Twisting Nether
  • tooltip:All damage done increased by ${{$s1=15}/10}.1%.
  • description:{$@spelldesc207994=Damaging enemies with your Fire, Frost, or Nature abilities increases all damage you deal by ${{$207995s1=15}/10}.1% for {$207995d=8 seconds}. Each element adds a separate application.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Stormbringer 64.0 7.0 4.6sec 4.2sec 20.29% 49.76% 10.8(11.3) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_stormbringer
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormbringer_1:20.29%

Trigger Attempt Success

  • trigger_pct:94.11%

Spelldata details

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike has no cooldown and its cost is reduced by {$s3=50}%.
  • description:{$@spelldesc201845=Your weapon attacks have a {$h=5}.1% chance to reset the remaining cooldown on Stormstrike, and cause your next Stormstrike to cost {$201846s3=50}% less Maelstrom and trigger no cooldown.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Stormlash 14.1 10.6 21.7sec 12.1sec 50.30% 50.30% 10.6(10.6) 13.6

Buff details

  • buff initial source:baseline
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormlash_1:50.30%

Trigger Attempt Success

  • trigger_pct:99.85%

Spelldata details

  • id:195222
  • name:Stormlash
  • tooltip:Empowered with lightning. Attacks and spellcasts have a chance to deal additional Nature damage.
  • description:{$@spelldesc195255=While your weapons are enhanced, your attacks have a chance to grant Stormlash to up to {$?s210731=false}[${$m1+$210731m1}][{$s1=2}] party or raid members for {$195222d=8 seconds}, causing attacks and spellcasts to deal additional Nature damage.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Unleash Doom 15.7 16.4 19.1sec 9.1sec 44.74% 50.88% 16.4(16.4) 15.2

Buff details

  • buff initial source:baseline
  • cooldown name:buff_unleash_doom
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-0.00

Stack Uptimes

  • unleash_doom_1:44.74%

Trigger Attempt Success

  • trigger_pct:20.04%

Spelldata details

  • id:199055
  • name:Unleash Doom
  • tooltip:Your special attacks will trigger an arc of fiery or lightning damage at your target.
  • description:{$@spelldesc198736=Stormstrike has a chance to unleash the power of |cFFFFCC99Doomhammer|r, causing your special attacks to heave molten lava or lightning spikes at your target for {$199053s1=1} Fire or Nature damage.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Wind Strikes 16.3 54.6 18.6sec 4.2sec 70.87% 78.65% 55.2(59.0) 15.6

Buff details

  • buff initial source:baseline
  • cooldown name:buff_wind_strikes
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.85

Stack Uptimes

  • wind_strikes_1:70.87%

Trigger Attempt Success

  • trigger_pct:94.11%

Spelldata details

  • id:198293
  • name:Wind Strikes
  • tooltip:Attack speed increased by $w1%.
  • description:{$@spelldesc198292=When Stormbringer resets the remaining cooldown on Stormstrike, you gain {$s1=3}% attack speed for {$198293d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
fiery_wolf: Alpha Wolf 1.6 0.6 97.3sec 53.4sec 73.71% 73.71% 7.6(7.6) 0.7

Buff details

  • buff initial source:baseline_fiery_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:73.71%

Trigger Attempt Success

  • trigger_pct:97.94%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
fiery_wolf: Alpha Wolf 1.6 0.9 108.3sec 44.0sec 77.15% 77.15% 8.4(8.4) 0.6

Buff details

  • buff initial source:baseline_fiery_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:77.15%

Trigger Attempt Success

  • trigger_pct:98.24%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
frost_wolf: Alpha Wolf 1.6 0.6 99.3sec 54.3sec 73.96% 73.96% 7.7(7.7) 0.7

Buff details

  • buff initial source:baseline_frost_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:73.96%

Trigger Attempt Success

  • trigger_pct:98.57%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
frost_wolf: Alpha Wolf 1.5 0.9 106.5sec 44.3sec 77.05% 77.05% 8.1(8.1) 0.6

Buff details

  • buff initial source:baseline_frost_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:77.05%

Trigger Attempt Success

  • trigger_pct:98.43%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Alpha Wolf 1.6 0.6 94.6sec 52.5sec 73.48% 73.48% 7.6(7.6) 0.7

Buff details

  • buff initial source:baseline_lightning_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:73.48%

Trigger Attempt Success

  • trigger_pct:98.03%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Alpha Wolf 1.6 0.9 108.1sec 45.7sec 76.80% 76.80% 8.4(8.4) 0.6

Buff details

  • buff initial source:baseline_lightning_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:76.80%

Trigger Attempt Success

  • trigger_pct:98.75%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Crackling Surge 4.1 0.0 22.3sec 22.3sec 75.99% 71.06% 0.0(0.0) 2.7

Buff details

  • buff initial source:baseline_lightning_wolf
  • cooldown name:buff_crackling_surge
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • crackling_surge_1:75.99%

Trigger Attempt Success

  • trigger_pct:99.65%

Spelldata details

  • id:224127
  • name:Crackling Surge
  • tooltip:Damage dealt increased by {$s1=50}%.
  • description:The Doom Wolf surges with electric energy, increasing all damage dealt by {$s1=50}%.
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Crackling Surge 4.2 0.0 23.6sec 23.6sec 76.04% 71.04% 0.0(0.0) 2.8

Buff details

  • buff initial source:baseline_lightning_wolf
  • cooldown name:buff_crackling_surge
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • crackling_surge_1:76.04%

Trigger Attempt Success

  • trigger_pct:99.83%

Spelldata details

  • id:224127
  • name:Crackling Surge
  • tooltip:Damage dealt increased by {$s1=50}%.
  • description:The Doom Wolf surges with electric energy, increasing all damage dealt by {$s1=50}%.
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:baseline
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:baseline
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:baseline
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201639
  • name:Well Fed
  • tooltip:Agility increased by $w1.
  • description:Agility increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Strength of Will

Buff details

  • buff initial source:baseline
  • cooldown name:buff_strength_of_will
  • max_stacks:10
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:304.77

Stack Uptimes

  • strength_of_will_10:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242642
  • name:Strength of Will
  • tooltip:Strength or Agility increased by {$s3=95}, based on your specialization.
  • description:{$@spelldesc242640=While you are above {$s1=80}% health you gain {$242642s3=95} Strength or Agility per second, based on your specialization, stacking up to {$242642u=10} times. If you fall below {$s2=50}% health, this effect is lost.}
  • max_stacks:10
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval
Flametongue: Windfury Attack 215.2 2.8sec
Frostbrand: Windfury Attack 213.0 2.8sec
Maelstrom Weapon: Windfury Attack 217.6 2.8sec
Stormbringer: Windfury Attack 13.4 22.0sec
Stormbringer: Windfury Attack Off-Hand 2.8 73.7sec
Flametongue: main_hand 105.4 2.8sec
Frostbrand: main_hand 103.6 2.8sec
Maelstrom Weapon: main_hand 107.0 2.8sec
Stormbringer: main_hand 7.9 31.8sec
Windfury: main_hand 30.4 9.3sec
Flametongue: Windlash 53.6 5.1sec
Frostbrand: Windlash 52.3 5.2sec
Maelstrom Weapon: Windlash 55.1 4.9sec
Stormbringer: Windlash 4.1 52.2sec
Windfury: Windlash 20.7 12.9sec
Flametongue: offhand 104.7 2.8sec
Frostbrand: offhand 103.7 2.9sec
Maelstrom Weapon: offhand 106.3 2.8sec
Stormbringer: offhand 7.9 31.9sec
Windfury: offhand 8.1 25.5sec
Flametongue: Windlash Off-Hand 53.7 5.1sec
Frostbrand: Windlash Off-Hand 52.3 5.2sec
Maelstrom Weapon: Windlash Off-Hand 55.2 4.9sec
Stormbringer: Windlash Off-Hand 4.1 52.0sec
Windfury: Windlash Off-Hand 10.9 21.4sec
Flametongue: Windstrike 66.1 5.1sec
Frostbrand: Windstrike 64.2 5.2sec
Stormbringer: Windstrike 5.2 44.7sec
Windfury: Windstrike 15.5 18.3sec
Unleash Doom (damage): Windstrike 46.7 7.1sec
Flametongue: Windstrike Off-Hand 66.1 5.1sec
Frostbrand: Windstrike Off-Hand 64.2 5.2sec
Stormbringer: Windstrike Off-Hand 5.1 45.4sec
Unleash Doom (damage): Windstrike Off-Hand 46.7 7.1sec
Stormbringer: Rockbiter 4.4 51.4sec
Unleash Doom (damage): Rockbiter 24.7 11.5sec
Flametongue: Crash Lightning 11.4 25.2sec
Frostbrand: Crash Lightning 11.4 25.2sec
Stormbringer: Crash Lightning 0.9 94.3sec
Windfury: Crash Lightning 2.6 68.8sec
Unleash Doom (damage): Crash Lightning 3.4 63.4sec
Stormbringer: Flametongue 1.5 89.6sec
Unleash Doom (damage): Flametongue 8.6 32.7sec
Stormbringer: Frostbrand 1.4 87.5sec
Unleash Doom (damage): Frostbrand 8.1 34.6sec
Flametongue: Stormstrike 91.7 3.8sec
Frostbrand: Stormstrike 91.7 3.8sec
Stormbringer: Stormstrike 6.7 34.6sec
Windfury: Stormstrike 20.7 13.6sec
Unleash Doom (damage): Stormstrike 51.7 6.5sec
Flametongue: Stormstrike Off-Hand 91.7 3.8sec
Frostbrand: Stormstrike Off-Hand 91.7 3.8sec
Stormbringer: Stormstrike Off-Hand 6.8 34.1sec
Unleash Doom (damage): Stormstrike Off-Hand 51.7 6.5sec
Flametongue: Lava Lash 45.4 6.3sec
Frostbrand: Lava Lash 45.4 6.3sec
Stormbringer: Lava Lash 3.4 60.8sec
Unleash Doom (damage): Lava Lash 13.9 19.3sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Windstrike0.7760.0018.77244.54712.016108.455
Feral Spirit1.2540.00121.2262.2290.00021.764
Doom Winds1.7060.00121.8067.1380.88332.750
Ascendance5.0590.26330.0445.2540.50630.044
Rockbiter3.5300.00518.80356.80521.691124.269
Crash Lightning22.2510.001235.211219.28868.367330.943
Flametongue7.0850.00228.777132.07784.880175.228
Stormstrike1.3670.00111.040110.78945.286244.402

Resources

Resource Usage Type Count Total Average RPE APR
baseline
crash_lightning Maelstrom 20.3 406.8 20.0 35.6 10115.3
frostbrand Maelstrom 33.6 672.2 20.0 35.6 53580.1
lava_lash Maelstrom 80.8 2424.5 30.0 53.4 15765.3
stormstrike Maelstrom 163.1 3789.7 23.2 51.7 18306.0
windstrike Maelstrom 121.7 611.6 5.0 11.2 117906.3
Resource Gains Type Count Total Average Overflow
Windfury Attack Maelstrom 387.23 2126.26 (26.36%) 5.49 584.37 21.56%
Main Hand Maelstrom 190.34 919.55 (11.40%) 4.83 32.17 3.38%
Windlash Maelstrom 98.03 371.43 (4.61%) 3.79 118.73 24.22%
Off-Hand Maelstrom 189.11 909.98 (11.28%) 4.81 35.55 3.76%
Windlash Off-Hand Maelstrom 98.17 367.74 (4.56%) 3.75 123.08 25.08%
Feral Spirit Maelstrom 177.68 578.75 (7.18%) 3.26 309.63 34.85%
Rockbiter Maelstrom 102.52 2791.22 (34.61%) 27.23 181.91 6.12%
Resource RPS-Gain RPS-Loss
Maelstrom 15.11 14.81
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 89.21 0.00 150.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data baseline Fight Length
Count 2497
Mean 299.94
Minimum 203.97
Maximum 399.18
Spread ( max - min ) 195.20
Range [ ( max - min ) / 2 * 100% ] 32.54%
Standard Deviation 42.2230
5th Percentile 235.64
95th Percentile 369.92
( 95th Percentile - 5th Percentile ) 134.28
Mean Distribution
Standard Deviation 0.8450
95.00% Confidence Intervall ( 298.29 - 301.60 )
Normalized 95.00% Confidence Intervall ( 99.45% - 100.55% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 762
0.1% Error 76123
0.1 Scale Factor Error with Delta=300 16
0.05 Scale Factor Error with Delta=300 61
0.01 Scale Factor Error with Delta=300 1522
DPS
Sample Data baseline Damage Per Second
Count 2497
Mean 1266174.69
Minimum 1073885.44
Maximum 1540569.62
Spread ( max - min ) 466684.19
Range [ ( max - min ) / 2 * 100% ] 18.43%
Standard Deviation 68976.8456
5th Percentile 1158445.86
95th Percentile 1384611.84
( 95th Percentile - 5th Percentile ) 226165.98
Mean Distribution
Standard Deviation 1380.3654
95.00% Confidence Intervall ( 1263469.22 - 1268880.15 )
Normalized 95.00% Confidence Intervall ( 99.79% - 100.21% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 115
0.1% Error 11401
0.1 Scale Factor Error with Delta=300 40615362
0.05 Scale Factor Error with Delta=300 162461448
0.01 Scale Factor Error with Delta=300 4061536196
Priority Target DPS
Sample Data baseline Priority Target Damage Per Second
Count 2497
Mean 1266277.28
Minimum 1084547.79
Maximum 1564803.01
Spread ( max - min ) 480255.22
Range [ ( max - min ) / 2 * 100% ] 18.96%
Standard Deviation 67422.3300
5th Percentile 1161145.19
95th Percentile 1382033.85
( 95th Percentile - 5th Percentile ) 220888.66
Mean Distribution
Standard Deviation 1349.2564
95.00% Confidence Intervall ( 1263632.78 - 1268921.77 )
Normalized 95.00% Confidence Intervall ( 99.79% - 100.21% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 109
0.1% Error 10891
0.1 Scale Factor Error with Delta=300 38805313
0.05 Scale Factor Error with Delta=300 155221250
0.01 Scale Factor Error with Delta=300 3880531231
DPS(e)
Sample Data baseline Damage Per Second (Effective)
Count 2497
Mean 1266174.69
Minimum 1073885.44
Maximum 1540569.62
Spread ( max - min ) 466684.19
Range [ ( max - min ) / 2 * 100% ] 18.43%
Damage
Sample Data baseline Damage
Count 2497
Mean 365994506.38
Minimum 290877520.71
Maximum 444920342.28
Spread ( max - min ) 154042821.57
Range [ ( max - min ) / 2 * 100% ] 21.04%
DTPS
Sample Data baseline Damage Taken Per Second
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data baseline Healing Per Second
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data baseline Healing Per Second (Effective)
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data baseline Heal
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data baseline Healing Taken Per Second
Count 2497
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data baseline Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data baselineTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data baseline Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
4 0.00 potion
5 0.00 lightning_shield
Default action list Executed every time the actor is available.
# count action,conditions
0.00 wind_shear
0.00 variable,name=hailstormCheck,value=((talent.hailstorm.enabled&!buff.frostbrand.up)|!talent.hailstorm.enabled)
0.00 variable,name=furyCheck80,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>80))
0.00 variable,name=furyCheck70,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>70))
0.00 variable,name=furyCheck45,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>45))
0.00 variable,name=furyCheck25,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>25))
0.00 variable,name=OCPool70,value=(!talent.overcharge.enabled|(talent.overcharge.enabled&maelstrom>70))
0.00 variable,name=OCPool60,value=(!talent.overcharge.enabled|(talent.overcharge.enabled&maelstrom>60))
0.00 variable,name=heartEquipped,value=(equipped.151819)
0.00 variable,name=akainuEquipped,value=(equipped.137084)
0.00 variable,name=akainuAS,value=(variable.akainuEquipped&buff.hot_hand.react&!buff.frostbrand.up)
0.00 variable,name=LightningCrashNotUp,value=(!buff.lightning_crash.up&set_bonus.tier20_2pc)
0.00 variable,name=alphaWolfCheck,value=((pet.frost_wolf.buff.alpha_wolf.remains<2&pet.fiery_wolf.buff.alpha_wolf.remains<2&pet.lightning_wolf.buff.alpha_wolf.remains<2)&feral_spirit.remains>4)
6 1.00 auto_attack
7 7.16 use_items
8 0.00 call_action_list,name=opener
9 54.78 windstrike,if=(variable.heartEquipped|set_bonus.tier19_2pc)&(!talent.earthen_spike.enabled|(cooldown.earthen_spike.remains>1&cooldown.doom_winds.remains>1)|debuff.earthen_spike.up)
A 0.00 call_action_list,name=buffs
B 0.00 call_action_list,name=CDs
C 0.00 call_action_list,name=core
D 0.00 call_action_list,name=filler
actions.CDs
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
E 2.03 berserking,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
0.00 blood_fury,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
F 1.00 potion,if=buff.ascendance.up|!talent.ascendance.enabled&feral_spirit.remains>5|target.time_to_die<=60
G 2.98 feral_spirit
H 5.32 doom_winds,if=debuff.earthen_spike.up&talent.earthen_spike.enabled|!talent.earthen_spike.enabled
I 2.04 ascendance,if=buff.doom_winds.up
actions.buffs
# count action,conditions
J 7.00 rockbiter,if=talent.landslide.enabled&!buff.landslide.up
0.00 fury_of_air,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
K 2.56 crash_lightning,if=artifact.alpha_wolf.rank&prev_gcd.1.feral_spirit
L 4.77 flametongue,if=!buff.flametongue.up
M 7.05 frostbrand,if=talent.hailstorm.enabled&!buff.frostbrand.up&variable.furyCheck45
N 2.28 flametongue,if=buff.flametongue.remains<6+gcd&cooldown.doom_winds.remains<gcd*2
O 2.67 frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<6+gcd&cooldown.doom_winds.remains<gcd*2
actions.core
# count action,conditions
0.00 earthen_spike,if=variable.furyCheck25
0.00 crash_lightning,if=!buff.crash_lightning.up&active_enemies>=2
0.00 windsong
0.00 crash_lightning,if=active_enemies>=8|(active_enemies>=6&talent.crashing_storm.enabled)
0.00 windstrike
P 40.23 stormstrike,if=buff.stormbringer.up&variable.furyCheck25
0.00 crash_lightning,if=active_enemies>=4|(active_enemies>=2&talent.crashing_storm.enabled)
0.00 lightning_bolt,if=talent.overcharge.enabled&variable.furyCheck45&maelstrom>=40
Q 33.14 stormstrike,if=(!talent.overcharge.enabled&variable.furyCheck45)|(talent.overcharge.enabled&variable.furyCheck80)
0.00 frostbrand,if=variable.akainuAS
0.00 lava_lash,if=buff.hot_hand.react&((variable.akainuEquipped&buff.frostbrand.up)|!variable.akainuEquipped)
0.00 sundering,if=active_enemies>=3
R 2.32 crash_lightning,if=active_enemies>=3|variable.LightningCrashNotUp|variable.alphaWolfCheck
actions.filler
# count action,conditions
S 49.78 rockbiter,if=maelstrom<120
T 10.46 flametongue,if=buff.flametongue.remains<4.8
0.00 rockbiter,if=maelstrom<=40
0.00 crash_lightning,if=(talent.crashing_storm.enabled|active_enemies>=2)&debuff.earthen_spike.up&maelstrom>=40&variable.OCPool60
U 9.17 frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<4.8&maelstrom>40
0.00 frostbrand,if=variable.akainuEquipped&!buff.frostbrand.up&maelstrom>=75
0.00 sundering
V 45.42 lava_lash,if=maelstrom>=50&variable.OCPool70&variable.furyCheck80
0.00 rockbiter
W 6.55 crash_lightning,if=(maelstrom>=65|talent.crashing_storm.enabled|active_enemies>=2)&variable.OCPool60&variable.furyCheck45
X 2.28 flametongue
actions.opener
# count action,conditions
Y 0.84 rockbiter,if=maelstrom<15&time<2

Sample Sequence

012467JLM999999999999J9N999M99EG9HI9R999J999R999999L9JMQSVSVVS7VTVQSPPPMSQSVWXSVWSQPPSMPXSPWSPOHQPQ99997J9FT99QVSUPQPQPPSQPPLPPSQSUSVVWPSQTSWUSV7PPPSPNGKOHPPQRJVPQVTVVVSUVVQSSVVSTVVSQUVSP7PPQSVVSTVWSUPPSPPXSQWSOHI999999EV9J9T99V9PQPQ7JMSVSTVVSQPQSPQPSMWTSQWSVPPQSU9999999LJO7GKHPQVSVRTVVVPQSUSVVPQSSTPQSVUVSPQVSVV

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask baseline 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom
Pre precombat 1 food baseline 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom
Pre precombat 2 augmentation baseline 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom potion_of_prolonged_power
0:00.000 default 6 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom potion_of_prolonged_power
0:00.000 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/150: 3% maelstrom potion_of_prolonged_power
0:00.000 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/150: 13% maelstrom potion_of_prolonged_power
0:01.106 buffs L flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/150: 35% maelstrom bloodlust, landslide, shock_of_the_twisting_nether, potion_of_prolonged_power
0:01.957 buffs M frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/150: 39% maelstrom bloodlust, flametongue, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, potion_of_prolonged_power
0:02.808 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/150: 29% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:03.660 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/150: 36% maelstrom bloodlust, ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:04.511 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom bloodlust, ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:05.363 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/150: 41% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:06.217 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/150: 57% maelstrom bloodlust, ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:07.072 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/150: 61% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:07.924 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/150: 78% maelstrom bloodlust, ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:08.775 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 137.0/150: 91% maelstrom bloodlust, ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:09.627 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 138.0/150: 92% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:10.479 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 149.0/150: 99% maelstrom bloodlust, ascendance, flametongue, frostbrand, stormbringer, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:11.330 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, ascendance, flametongue, frostbrand, stormbringer, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:12.182 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, ascendance, flametongue, frostbrand, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:13.034 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, ascendance, flametongue, frostbrand, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:13.886 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:14.737 buffs N flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:15.588 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:16.440 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 147.0/150: 98% maelstrom bloodlust, ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:17.292 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 148.0/150: 99% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:18.141 buffs M frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, ascendance, flametongue, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:18.991 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom bloodlust, ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:19.845 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 136.0/150: 91% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:20.697 CDs E berserking Fluffy_Pillow 220000.0/220000: 100% mana | 138.0/150: 92% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:20.697 CDs G feral_spirit Fluffy_Pillow 220000.0/220000: 100% mana | 138.0/150: 92% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:21.452 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:22.207 CDs H doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:22.207 CDs I ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:22.207 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:22.961 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:23.715 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, doom_winds, unleash_doom, wind_strikes, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:24.468 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, stormbringer, doom_winds, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:25.223 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, doom_winds, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:25.976 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, doom_winds, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:26.729 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:27.485 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:28.240 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:28.994 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:29.749 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 145.0/150: 97% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, landslide, wind_strikes, gathering_storms, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:30.504 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, berserking, ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:31.259 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, ascendance, flametongue, frostbrand, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:32.110 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:32.962 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:33.813 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, ascendance, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:34.664 buffs L flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, ascendance, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:35.516 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, ascendance, flametongue, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:36.367 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, ascendance, flametongue, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:37.217 buffs M frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, flametongue, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:38.069 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom bloodlust, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:38.920 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom bloodlust, flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:39.773 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 129.0/150: 86% maelstrom bloodlust, flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:40.624 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/150: 73% maelstrom bloodlust, flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:41.476 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 143.0/150: 95% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:42.580 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 132.0/150: 88% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:43.687 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/150: 71% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:44.893 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 141.0/150: 94% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:44.893 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 141.0/150: 94% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:45.998 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/150: 77% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:47.102 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 126.0/150: 84% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:48.207 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/150: 64% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:49.313 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/150: 41% maelstrom flametongue, frostbrand, landslide, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:50.419 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:51.523 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:52.627 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:53.734 buffs M frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:54.838 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:55.943 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/150: 39% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:57.049 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/150: 16% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
0:58.154 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/150: 48% maelstrom flametongue, frostbrand, landslide, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
0:59.260 filler W crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/150: 31% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:00.365 filler X flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/150: 18% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:01.471 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/150: 21% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:02.577 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/150: 44% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:03.683 filler W crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/150: 27% maelstrom flametongue, frostbrand, landslide, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:04.789 Waiting     0.800 sec 220000.0/220000: 100% mana | 31.0/150: 21% maelstrom flametongue, frostbrand, landslide, gathering_storms, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:05.589 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/150: 21% maelstrom flametongue, frostbrand, landslide, gathering_storms, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:06.925 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:08.063 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:09.167 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/150: 19% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:10.272 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/150: 9% maelstrom flametongue, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:11.378 buffs M frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/150: 29% maelstrom flametongue, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:12.482 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/150: 19% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:13.585 filler X flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/150: 9% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:14.692 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/150: 12% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:15.796 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/150: 35% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:16.902 filler W crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/150: 25% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:18.006 Waiting     0.800 sec 220000.0/220000: 100% mana | 27.0/150: 18% maelstrom flametongue, frostbrand, landslide, wind_strikes, gathering_storms, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:18.806 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/150: 18% maelstrom flametongue, frostbrand, landslide, wind_strikes, gathering_storms, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:20.142 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/150: 41% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:21.246 buffs O frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, landslide, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:22.352 CDs H doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, landslide, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:22.352 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, landslide, doom_winds, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:23.456 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/150: 19% maelstrom flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:24.561 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/150: 41% maelstrom flametongue, frostbrand, landslide, doom_winds, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:25.666 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/150: 36% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:26.771 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/150: 46% maelstrom ascendance, flametongue, frostbrand, landslide, doom_winds, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:27.875 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/150: 75% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:28.977 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/150: 76% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:30.083 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/150: 74% maelstrom ascendance, flametongue, frostbrand, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:30.083 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/150: 74% maelstrom ascendance, flametongue, frostbrand, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:31.189 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:32.294 CDs F potion Fluffy_Pillow 220000.0/220000: 100% mana | 147.0/150: 98% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
1:32.294 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 147.0/150: 98% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:33.399 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:34.504 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:35.611 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:36.718 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:37.822 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:38.927 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 129.0/150: 86% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:40.034 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 128.0/150: 85% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:41.139 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/150: 75% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:42.244 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/150: 61% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:43.351 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/150: 51% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:44.456 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/150: 28% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:45.562 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/150: 27% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:46.666 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/150: 17% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:47.772 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:48.879 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/150: 29% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:49.984 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/150: 19% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:51.089 buffs L flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/150: 9% maelstrom frostbrand, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:52.195 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/150: 16% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:53.300 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/150: 15% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:54.406 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/150: 15% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:55.512 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/150: 41% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:56.616 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/150: 17% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:57.720 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:58.824 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
1:59.929 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/150: 53% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:01.035 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/150: 36% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:02.141 filler W crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/150: 19% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:03.249 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/150: 22% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:04.354 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/150: 12% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:05.459 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/150: 35% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:06.566 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/150: 8% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:07.673 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/150: 8% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:08.778 filler W crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/150: 27% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:09.885 Waiting     1.800 sec 220000.0/220000: 100% mana | 31.0/150: 21% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:11.685 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:12.792 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:13.897 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/150: 49% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:15.001 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/150: 33% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:15.001 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/150: 33% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:16.105 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/150: 32% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:17.209 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/150: 25% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:18.314 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/150: 12% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:19.419 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/150: 35% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:20.524 buffs N flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/150: 25% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:21.630 CDs G feral_spirit Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/150: 28% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:22.736 buffs K crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/150: 41% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:23.841 buffs O frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/150: 38% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:24.945 CDs H doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/150: 35% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:24.945 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/150: 35% maelstrom flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:26.050 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/150: 63% maelstrom flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:27.155 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/150: 56% maelstrom flametongue, frostbrand, landslide, doom_winds, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:28.262 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/150: 52% maelstrom flametongue, frostbrand, landslide, doom_winds, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:29.369 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/150: 71% maelstrom flametongue, frostbrand, doom_winds, wind_strikes, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:30.474 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, doom_winds, wind_strikes, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:31.579 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether, potion_of_prolonged_power
2:32.685 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:33.789 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 149.0/150: 99% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:34.894 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 139.0/150: 93% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:35.999 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:37.105 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 149.0/150: 99% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:38.212 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 129.0/150: 86% maelstrom flametongue, frostbrand, landslide, unleash_doom, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:39.316 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/150: 66% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:40.421 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 147.0/150: 98% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:41.526 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 132.0/150: 88% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:42.631 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/150: 81% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:43.736 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/150: 64% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:44.843 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:45.948 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/150: 76% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:47.055 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 148.0/150: 99% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:48.161 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/150: 82% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:49.266 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/150: 65% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:50.370 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 132.0/150: 88% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:51.476 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 137.0/150: 91% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:52.583 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/150: 71% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:53.689 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/150: 55% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:54.795 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/150: 77% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:55.898 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:57.004 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:58.110 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
2:59.216 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/150: 59% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:00.323 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/150: 59% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:00.323 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/150: 59% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:01.428 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/150: 52% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:02.534 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/150: 42% maelstrom flametongue, frostbrand, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:03.639 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/150: 28% maelstrom flametongue, frostbrand, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:04.744 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/150: 54% maelstrom flametongue, frostbrand, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:05.848 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/150: 34% maelstrom flametongue, frostbrand, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:06.955 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/150: 17% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:08.060 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:09.165 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:10.269 filler W crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:11.375 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, frostbrand, landslide, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:12.480 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/150: 39% maelstrom flametongue, frostbrand, landslide, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:13.586 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/150: 29% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:14.693 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/150: 19% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:15.797 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/150: 6% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:16.903 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/150: 29% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:18.008 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/150: 19% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:19.113 filler X flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/150: 9% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:20.219 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/150: 12% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:21.326 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/150: 35% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:22.433 Waiting     0.200 sec 220000.0/220000: 100% mana | 17.0/150: 11% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:22.633 filler W crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/150: 24% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:23.738 Waiting     0.600 sec 220000.0/220000: 100% mana | 16.0/150: 11% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:24.338 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/150: 11% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:25.603 buffs O frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:26.709 CDs H doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:26.709 CDs I ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, landslide, doom_winds, gathering_storms, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:26.709 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom ascendance, flametongue, frostbrand, landslide, doom_winds, gathering_storms, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:27.813 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/150: 34% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:28.918 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom ascendance, flametongue, frostbrand, landslide, doom_winds, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:30.024 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:31.129 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 139.0/150: 93% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, doom_winds, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:32.236 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom ascendance, flametongue, frostbrand, landslide, doom_winds, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:33.343 CDs E berserking Fluffy_Pillow 220000.0/220000: 100% mana | 147.0/150: 98% maelstrom ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:33.343 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 147.0/150: 98% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:34.307 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/150: 81% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:35.268 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/150: 83% maelstrom berserking, ascendance, flametongue, frostbrand, unleash_doom, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:36.231 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, unleash_doom, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:37.192 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 147.0/150: 98% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, unleash_doom, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:38.153 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom berserking, ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:39.114 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:40.076 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:41.037 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 144.0/150: 96% maelstrom berserking, ascendance, flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:41.999 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom berserking, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:42.961 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom berserking, flametongue, frostbrand, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:43.924 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/150: 76% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:45.027 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/150: 66% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:46.132 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/150: 43% maelstrom flametongue, frostbrand, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:46.132 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/150: 43% maelstrom flametongue, frostbrand, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:47.239 buffs M frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/150: 69% maelstrom flametongue, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:48.345 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/150: 59% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:49.448 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/150: 81% maelstrom flametongue, frostbrand, landslide, unleash_doom, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:50.555 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/150: 65% maelstrom flametongue, frostbrand, landslide, unleash_doom, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:51.659 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 131.0/150: 87% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:52.764 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 136.0/150: 91% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:53.870 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/150: 74% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:54.976 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/150: 54% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:56.081 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 129.0/150: 86% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:57.187 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/150: 66% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:58.290 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/150: 56% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
3:59.395 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/150: 36% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:00.501 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/150: 55% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:01.607 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/150: 45% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:02.713 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/150: 22% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:03.818 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/150: 12% maelstrom flametongue, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:04.923 buffs M frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/150: 35% maelstrom flametongue, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:06.027 filler W crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/150: 25% maelstrom flametongue, frostbrand, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:07.134 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/150: 15% maelstrom flametongue, frostbrand, landslide, wind_strikes, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:08.239 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/150: 18% maelstrom flametongue, frostbrand, landslide, wind_strikes, gathering_storms, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:09.345 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, landslide, gathering_storms, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:10.449 filler W crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, landslide, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:11.554 Waiting     0.800 sec 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, frostbrand, landslide, gathering_storms, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:12.354 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/150: 29% maelstrom flametongue, frostbrand, landslide, gathering_storms, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:13.674 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/150: 52% maelstrom flametongue, frostbrand, landslide, gathering_storms, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:14.780 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/150: 45% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:15.885 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/150: 44% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:16.991 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/150: 31% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:18.097 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/150: 11% maelstrom ascendance, flametongue, frostbrand, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:19.204 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom ascendance, flametongue, frostbrand, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:20.312 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:21.417 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:22.522 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/150: 37% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:23.629 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/150: 38% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:24.735 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/150: 61% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:25.840 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/150: 71% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, wind_strikes, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:26.946 default 9 windstrike Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/150: 75% maelstrom ascendance, flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:28.052 buffs L flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 127.0/150: 85% maelstrom frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:29.158 buffs J rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 132.0/150: 88% maelstrom flametongue, frostbrand, stormbringer, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:30.264 buffs O frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:31.370 default 7 use_items Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:31.370 CDs G feral_spirit Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:32.474 buffs K crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:33.578 CDs H doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer, landslide, gathering_storms, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:33.578 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer, landslide, doom_winds, gathering_storms, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:34.685 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, doom_winds, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:35.791 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 139.0/150: 93% maelstrom flametongue, frostbrand, landslide, doom_winds, unleash_doom, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:36.896 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/150: 79% maelstrom flametongue, frostbrand, landslide, doom_winds, unleash_doom, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:38.000 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, doom_winds, unleash_doom, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:39.107 core R crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 149.0/150: 99% maelstrom flametongue, frostbrand, landslide, doom_winds, unleash_doom, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:40.214 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, unleash_doom, gathering_storms, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:41.319 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:42.425 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:43.532 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, landslide, gathering_storms, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:44.638 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, gathering_storms, stormlash, concordance_of_the_legionfall, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:45.743 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/150: 76% maelstrom flametongue, frostbrand, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:46.848 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/150: 65% maelstrom flametongue, frostbrand, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:47.953 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 132.0/150: 88% maelstrom flametongue, frostbrand, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:49.058 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/150: 78% maelstrom flametongue, frostbrand, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:50.164 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:51.272 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom flametongue, frostbrand, landslide, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:52.377 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/150: 79% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:53.482 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/150: 66% maelstrom flametongue, frostbrand, landslide, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:54.587 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/150: 43% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:55.692 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/150: 65% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:56.798 filler T flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 146.0/150: 97% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:57.905 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, stormbringer, landslide, unleash_doom, wind_strikes, stormlash, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
4:59.008 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
5:00.115 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
5:01.220 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 139.0/150: 93% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
5:02.326 filler U frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/150: 76% maelstrom flametongue, frostbrand, landslide, unleash_doom, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
5:03.431 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/150: 66% maelstrom flametongue, frostbrand, landslide, unleash_doom, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
5:04.536 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/150: 49% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
5:05.639 core P stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 127.0/150: 85% maelstrom flametongue, frostbrand, stormbringer, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
5:06.746 core Q stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/150: 71% maelstrom flametongue, frostbrand, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
5:07.852 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/150: 48% maelstrom flametongue, frostbrand, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
5:08.958 filler S rockbiter Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/150: 35% maelstrom flametongue, frostbrand, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
5:10.064 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, landslide, wind_strikes, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether
5:11.169 filler V lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, landslide, fire_of_the_twisting_nether, shock_of_the_twisting_nether, chill_of_the_twisting_nether

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4728 4403 0
Agility 44332 38901 28018 (24626)
Stamina 81377 81377 45295
Intellect 7649 7324 0
Spirit 1 1 0
Health 4882620 4882620 0
Mana 220000 220000 0
Maelstrom 150 150 0
Spell Power 53198 46681 0
Crit 18.60% 18.60% 3439
Haste 36.17% 36.17% 13565
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 44332 38901 0
Mastery 60.58% 60.58% 8916
Armor 3282 3282 3282
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 939.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_hidden_satyr
Local Shoulders Pauldrons of the Skybreaker
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +871 Crit, +515 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Flesh-Raking Leggings
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Mastery }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }, gems: { +150 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Eye of the Twisting Nether
ilevel: 970, stats: { +3515 Sta, +2884 Haste, +1602 Mastery }, gems: { +200 Agi }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Specter of Betrayal
ilevel: 940, stats: { +2994 StrAgi }
Local Trinket2 Cradle of Anguish
ilevel: 930, stats: { +1320 Haste }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Agi }
Local Main Hand Doomhammer
ilevel: 951, weapon: { 8445 - 15685, 2.6 }, stats: { +1496 Agi, +2244 Sta, +435 Crit, +418 Mastery }, relics: { +67 ilevels, +67 ilevels, +67 ilevels }
Local Off Hand Fury of the Stonemother
ilevel: 951, weapon: { 8445 - 15685, 2.6 }, stats: { +1496 Agi, +2244 Sta, +435 Crit, +418 Mastery }

Talents

Level
15 Windsong (Enhancement Shaman) Hot Hand (Enhancement Shaman) Landslide (Enhancement Shaman)
30 Rainfall (Enhancement Shaman) Feral Lunge (Enhancement Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Lightning Shield (Enhancement Shaman) Ancestral Swiftness Hailstorm (Enhancement Shaman)
75 Tempest (Enhancement Shaman) Overcharge (Enhancement Shaman) Empowered Stormlash (Enhancement Shaman)
90 Crashing Storm (Enhancement Shaman) Fury of Air (Enhancement Shaman) Sundering (Enhancement Shaman)
100 Ascendance (Enhancement Shaman) Boulderfist (Enhancement Shaman) Earthen Spike (Enhancement Shaman)

Profile

shaman="baseline"
spec=enhancement
level=110
race=troll
role=attack
position=back
talents=3133111
artifact=41:0:0:0:0:899:1:900:1:901:1:902:1:903:1:904:1:905:4:906:4:907:4:908:4:909:4:910:4:911:4:912:4:913:4:930:1:1351:1:1388:1:1593:4:1594:1:1595:1:1596:1:1687:1

# Default consumables
potion=prolonged_power
flask=seventh_demon
food=lavish_suramar_feast
augmentation=defiled

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/lightning_shield

# Executed every time the actor is available.
actions=wind_shear
actions+=/variable,name=hailstormCheck,value=((talent.hailstorm.enabled&!buff.frostbrand.up)|!talent.hailstorm.enabled)
actions+=/variable,name=furyCheck80,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>80))
actions+=/variable,name=furyCheck70,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>70))
actions+=/variable,name=furyCheck45,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>45))
actions+=/variable,name=furyCheck25,value=(!talent.fury_of_air.enabled|(talent.fury_of_air.enabled&maelstrom>25))
actions+=/variable,name=OCPool70,value=(!talent.overcharge.enabled|(talent.overcharge.enabled&maelstrom>70))
actions+=/variable,name=OCPool60,value=(!talent.overcharge.enabled|(talent.overcharge.enabled&maelstrom>60))
actions+=/variable,name=heartEquipped,value=(equipped.151819)
actions+=/variable,name=akainuEquipped,value=(equipped.137084)
actions+=/variable,name=akainuAS,value=(variable.akainuEquipped&buff.hot_hand.react&!buff.frostbrand.up)
actions+=/variable,name=LightningCrashNotUp,value=(!buff.lightning_crash.up&set_bonus.tier20_2pc)
actions+=/variable,name=alphaWolfCheck,value=((pet.frost_wolf.buff.alpha_wolf.remains<2&pet.fiery_wolf.buff.alpha_wolf.remains<2&pet.lightning_wolf.buff.alpha_wolf.remains<2)&feral_spirit.remains>4)
actions+=/auto_attack
actions+=/use_items
actions+=/call_action_list,name=opener
actions+=/windstrike,if=(variable.heartEquipped|set_bonus.tier19_2pc)&(!talent.earthen_spike.enabled|(cooldown.earthen_spike.remains>1&cooldown.doom_winds.remains>1)|debuff.earthen_spike.up)
actions+=/call_action_list,name=buffs
actions+=/call_action_list,name=CDs
actions+=/call_action_list,name=core
actions+=/call_action_list,name=filler

actions.CDs=bloodlust,if=target.health.pct<25|time>0.500
actions.CDs+=/berserking,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
actions.CDs+=/blood_fury,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
actions.CDs+=/potion,if=buff.ascendance.up|!talent.ascendance.enabled&feral_spirit.remains>5|target.time_to_die<=60
actions.CDs+=/feral_spirit
actions.CDs+=/doom_winds,if=debuff.earthen_spike.up&talent.earthen_spike.enabled|!talent.earthen_spike.enabled
actions.CDs+=/ascendance,if=buff.doom_winds.up

actions.buffs=rockbiter,if=talent.landslide.enabled&!buff.landslide.up
actions.buffs+=/fury_of_air,if=buff.ascendance.up|(feral_spirit.remains>5)|level<100
actions.buffs+=/crash_lightning,if=artifact.alpha_wolf.rank&prev_gcd.1.feral_spirit
actions.buffs+=/flametongue,if=!buff.flametongue.up
actions.buffs+=/frostbrand,if=talent.hailstorm.enabled&!buff.frostbrand.up&variable.furyCheck45
actions.buffs+=/flametongue,if=buff.flametongue.remains<6+gcd&cooldown.doom_winds.remains<gcd*2
actions.buffs+=/frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<6+gcd&cooldown.doom_winds.remains<gcd*2

actions.core=earthen_spike,if=variable.furyCheck25
actions.core+=/crash_lightning,if=!buff.crash_lightning.up&active_enemies>=2
actions.core+=/windsong
actions.core+=/crash_lightning,if=active_enemies>=8|(active_enemies>=6&talent.crashing_storm.enabled)
actions.core+=/windstrike
actions.core+=/stormstrike,if=buff.stormbringer.up&variable.furyCheck25
actions.core+=/crash_lightning,if=active_enemies>=4|(active_enemies>=2&talent.crashing_storm.enabled)
actions.core+=/lightning_bolt,if=talent.overcharge.enabled&variable.furyCheck45&maelstrom>=40
actions.core+=/stormstrike,if=(!talent.overcharge.enabled&variable.furyCheck45)|(talent.overcharge.enabled&variable.furyCheck80)
actions.core+=/frostbrand,if=variable.akainuAS
actions.core+=/lava_lash,if=buff.hot_hand.react&((variable.akainuEquipped&buff.frostbrand.up)|!variable.akainuEquipped)
actions.core+=/sundering,if=active_enemies>=3
actions.core+=/crash_lightning,if=active_enemies>=3|variable.LightningCrashNotUp|variable.alphaWolfCheck

actions.filler=rockbiter,if=maelstrom<120
actions.filler+=/flametongue,if=buff.flametongue.remains<4.8
actions.filler+=/rockbiter,if=maelstrom<=40
actions.filler+=/crash_lightning,if=(talent.crashing_storm.enabled|active_enemies>=2)&debuff.earthen_spike.up&maelstrom>=40&variable.OCPool60
actions.filler+=/frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<4.8&maelstrom>40
actions.filler+=/frostbrand,if=variable.akainuEquipped&!buff.frostbrand.up&maelstrom>=75
actions.filler+=/sundering
actions.filler+=/lava_lash,if=maelstrom>=50&variable.OCPool70&variable.furyCheck80
actions.filler+=/rockbiter
actions.filler+=/crash_lightning,if=(maelstrom>=65|talent.crashing_storm.enabled|active_enemies>=2)&variable.OCPool60&variable.furyCheck45
actions.filler+=/flametongue

actions.opener=rockbiter,if=maelstrom<15&time<2

head=helmet_of_the_skybreaker,id=147178,bonus_id=1512/3563
neck=string_of_extracted_incisors,id=147013,bonus_id=1512/3563,enchant_id=5439
shoulders=pauldrons_of_the_skybreaker,id=147180,bonus_id=1512/3563
back=drape_of_the_skybreaker,id=147176,bonus_id=1512/3563,enchant_id=5435
chest=harness_of_the_skybreaker,id=147175,bonus_id=1512/3563
wrists=painsinged_armguards,id=147057,bonus_id=1512/3563
hands=smoldering_heart,id=151819,bonus_id=3570
waist=waistguard_of_interminable_unity,id=147056,bonus_id=1512/3563
legs=fleshraking_leggings,id=147051,bonus_id=1512/3563
feet=starstalker_treads,id=147046,bonus_id=1522/3563,gem_id=130222
finger1=eye_of_the_twisting_nether,id=137050,bonus_id=3570,gem_id=130247,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,bonus_id=1512/3563,enchant=200haste
trinket1=specter_of_betrayal,id=151190,bonus_id=1522/3563
trinket2=cradle_of_anguish,id=147010,bonus_id=1512/3563
main_hand=doomhammer,id=128819,bonus_id=745,gem_id=147088/147100/147115,relic_id=1512:3563/1512:3563/1512:3563
off_hand=fury_of_the_stonemother,id=128873,gem_id=0/0/0/0,relic_id=0/0

# Gear Summary
# gear_ilvl=938.88
# gear_agility=28018
# gear_stamina=45295
# gear_crit_rating=3439
# gear_haste_rating=13565
# gear_mastery_rating=8916
# gear_versatility_rating=2624
# gear_armor=3282

Simulation & Raid Information

Iterations: 2500
Threads: 3
Confidence: 95.00%
Fight Length: 198 - 427 ( 300.3 )

Performance:

Total Events Processed: 113868694
Max Event Queue: 110
Sim Seconds: 750846
CPU Seconds: 155.0625
Physical Seconds: 86.4438
Speed Up: 4842

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
T19 2pc T19 2pc ascendance 114051 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 184.98sec 0 300.30sec
T19 2pc T19 2pc augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.30sec
T19 2pc T19 2pc berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 189.47sec 0 300.30sec
T19 2pc T19 2pc crash_lightning 187874 2604469 8673 2.33 189217 378462 11.6 11.6 18.3% 0.0% 0.0% 0.0% 25.04sec 2604469 300.30sec
T19 2pc T19 2pc crashing_storm 210801 1578038 5255 16.13 16497 32983 80.7 80.7 18.5% 0.0% 0.0% 0.0% 3.40sec 1578038 300.30sec
T19 2pc T19 2pc doom_winds 204945 0 0 0.00 0 0 5.3 0.0 0.0% 0.0% 0.0% 0.0% 61.63sec 0 300.30sec
T19 2pc T19 2pc dread_torrent 246464 11801899 39300 10.58 187694 375382 53.0 53.0 18.7% 0.0% 0.0% 0.0% 10.59sec 11801899 300.30sec
T19 2pc T19 2pc dread_torrent_driver 246463 0 0 0.00 0 0 28.5 0.0 0.0% 0.0% 0.0% 0.0% 10.59sec 0 300.30sec
T19 2pc T19 2pc feral_spirit 51533 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 121.02sec 0 300.30sec
T19 2pc T19 2pc flametongue 193796 4535627 15103 3.97 192229 384191 19.9 19.9 18.7% 0.0% 0.0% 0.0% 15.42sec 4535627 300.30sec
T19 2pc T19 2pc flametongue_attack 10444 15202308 50623 180.49 14188 28380 903.3 903.3 18.6% 0.0% 0.0% 0.0% 0.60sec 15202308 300.30sec
T19 2pc T19 2pc flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.30sec
T19 2pc T19 2pc food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.30sec
T19 2pc T19 2pc frostbrand 196834 2664945 8874 3.78 118716 237012 18.9 18.9 18.8% 0.0% 0.0% 0.0% 16.19sec 2664945 300.30sec
T19 2pc T19 2pc hailstorm 210854 33324658 110970 178.24 31501 63002 892.1 892.1 18.6% 0.0% 0.0% 0.0% 0.60sec 33324658 300.30sec
T19 2pc T19 2pc lava_lash 60103 34329080 114315 9.09 636112 1273241 45.5 45.5 18.6% 0.0% 0.0% 0.0% 6.25sec 34329080 300.30sec
T19 2pc T19 2pc doom_vortex_ll 199116 3968580 13215 10.81 61844 123718 54.1 54.1 18.6% 0.0% 0.0% 0.0% 4.88sec 3968580 300.30sec
T19 2pc T19 2pc main_hand 0 5669153 18878 26.55 42789 85584 132.9 132.9 18.6% 18.9% 0.0% 0.0% 2.26sec 8334192 300.30sec
T19 2pc T19 2pc mark_of_the_hidden_satyr 191259 6237990 20772 4.09 257334 514293 20.5 20.5 18.5% 0.0% 0.0% 0.0% 14.62sec 6237990 300.30sec
T19 2pc T19 2pc offhand 1 2822562 9399 26.44 21408 42815 132.3 132.3 18.5% 18.9% 0.0% 0.0% 2.26sec 4149433 300.30sec
T19 2pc T19 2pc potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.30sec
T19 2pc T19 2pc rockbiter 193786 30192004 100538 11.56 440295 880609 57.9 57.9 18.5% 0.0% 0.0% 0.0% 5.13sec 30192004 300.30sec
T19 2pc T19 2pc specter_of_betrayal_driver 246461 0 0 0.00 0 0 7.2 0.0 0.0% 0.0% 0.0% 0.0% 45.25sec 0 300.30sec
T19 2pc T19 2pc stormlash 213307 11460126 38162 140.06 16349 0 701.0 701.0 0.0% 0.0% 0.0% 0.0% 1.08sec 11460126 300.30sec
T19 2pc T19 2pc stormstrike 17364 0 0 0.00 0 0 73.9 0.0 0.0% 0.0% 0.0% 0.0% 3.74sec 0 300.30sec
T19 2pc T19 2pc stormstrike_mh 32175 51278667 170756 18.43 366097 889938 92.2 92.2 36.2% 0.0% 0.0% 0.0% 3.74sec 75384498 300.30sec
T19 2pc T19 2pc stormstrike_offhand 32176 25645811 85400 18.43 182903 445519 92.2 92.2 36.2% 0.0% 0.0% 0.0% 3.74sec 37701772 300.30sec
T19 2pc T19 2pc unleash_lava 199053 13456535 44810 24.94 90883 181789 126.4 124.8 18.6% 0.0% 0.0% 0.0% 3.20sec 13456535 300.30sec
T19 2pc T19 2pc unleash_lightning 199054 13529134 45052 25.08 90896 181764 127.1 125.5 18.6% 0.0% 0.0% 0.0% 3.18sec 13529134 300.30sec
T19 2pc T19 2pc wind_lash 114089 4070372 13554 10.83 63222 126485 54.2 54.2 18.7% 0.0% 0.0% 0.0% 4.96sec 4070372 300.30sec
T19 2pc T19 2pc wind_lash_offhand 114093 2036688 6782 10.84 31614 63224 54.3 54.3 18.7% 0.0% 0.0% 0.0% 4.96sec 2036688 300.30sec
T19 2pc T19 2pc windfury_attack 25504 20795025 69247 35.73 98106 195548 178.8 178.8 18.6% 0.0% 0.0% 0.0% 3.39sec 30570656 300.30sec
T19 2pc T19 2pc windfury_attack_oh 33750 4237091 14109 7.65 93583 187134 38.3 38.3 18.3% 0.0% 0.0% 0.0% 14.85sec 6228925 300.30sec
T19 2pc T19 2pc windstrike 115356 0 0 0.00 0 0 53.9 0.0 0.0% 0.0% 0.0% 0.0% 4.98sec 0 300.30sec
T19 2pc T19 2pc windstrike_mh 115357 52097762 173484 13.46 533027 1273723 67.4 67.4 32.5% 0.0% 0.0% 0.0% 4.98sec 52097762 300.30sec
T19 2pc T19 2pc windstrike_offhand 115360 26058829 86775 13.46 266301 637750 67.4 67.4 32.5% 0.0% 0.0% 0.0% 4.98sec 26058829 300.30sec
T19 2pc T19 2pc_frost_wolf frozen_bite 224126 2580528 127578 24.03 268775 536965 8.1 8.1 18.6% 0.0% 0.0% 0.0% 29.74sec 2580528 20.23sec
T19 2pc T19 2pc_frost_wolf melee 0 1818637 89911 138.83 32757 65451 46.8 46.8 18.7% 0.0% 0.0% 0.0% 4.56sec 2673569 20.23sec
T19 2pc T19 2pc_frost_wolf snowstorm 198483 1223739 60500 42.37 72062 144308 14.3 14.3 18.8% 0.0% 0.0% 0.0% 14.84sec 1223739 20.23sec
T19 2pc T19 2pc_fiery_wolf fiery_jaws 224125 1759057 83109 23.44 179170 359147 8.3 8.3 18.6% 0.0% 0.0% 0.0% 30.08sec 4108541 21.17sec
T19 2pc T19 2pc_fiery_wolf fiery_jaws ticks -224125 2349484 7832 6.54 71829 0 8.3 32.7 0.0% 0.0% 0.0% 0.0% 30.08sec 4108541 21.17sec
T19 2pc T19 2pc_fiery_wolf fire_nova 198480 1250139 59065 41.44 72134 144111 14.6 14.6 18.6% 0.0% 0.0% 0.0% 15.00sec 1250139 21.17sec
T19 2pc T19 2pc_fiery_wolf melee 0 1861207 87935 135.89 32776 65553 47.9 47.9 18.5% 0.0% 0.0% 0.0% 4.57sec 2736151 21.17sec
T19 2pc T19 2pc_lightning_wolf crackling_surge 224127 0 0 0.00 0 0 8.3 0.0 0.0% 0.0% 0.0% 0.0% 30.29sec 0 20.66sec
T19 2pc T19 2pc_lightning_wolf melee 0 2600439 125876 139.62 45590 91200 48.1 48.1 18.6% 0.0% 0.0% 0.0% 4.58sec 3822891 20.66sec
T19 2pc T19 2pc_lightning_wolf thunder_bite 198485 1794371 86858 42.17 104351 208664 14.5 14.5 18.4% 0.0% 0.0% 0.0% 15.00sec 1794371 20.66sec
T19 2pc - T20 4pc T19 2pc - T20 4pc ascendance 114051 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.06sec 0 300.31sec
T19 2pc - T20 4pc T19 2pc - T20 4pc augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.31sec
T19 2pc - T20 4pc T19 2pc - T20 4pc berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 189.61sec 0 300.31sec
T19 2pc - T20 4pc T19 2pc - T20 4pc crash_lightning 187874 16287782 54237 4.24 646464 1233871 21.2 21.2 20.7% 0.0% 0.0% 0.0% 14.24sec 16287782 300.31sec
T19 2pc - T20 4pc T19 2pc - T20 4pc crashing_storm 210801 2993448 9968 29.35 16494 32978 146.9 146.9 23.6% 0.0% 0.0% 0.0% 2.00sec 2993448 300.31sec
T19 2pc - T20 4pc T19 2pc - T20 4pc doom_winds 204945 0 0 0.00 0 0 5.3 0.0 0.0% 0.0% 0.0% 0.0% 61.67sec 0 300.31sec
T19 2pc - T20 4pc T19 2pc - T20 4pc dread_torrent 246464 12192644 40601 10.58 187683 375466 52.9 52.9 22.7% 0.0% 0.0% 0.0% 10.59sec 12192644 300.31sec
T19 2pc - T20 4pc T19 2pc - T20 4pc dread_torrent_driver 246463 0 0 0.00 0 0 28.5 0.0 0.0% 0.0% 0.0% 0.0% 10.59sec 0 300.31sec
T19 2pc - T20 4pc T19 2pc - T20 4pc feral_spirit 51533 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 121.12sec 0 300.31sec
T19 2pc - T20 4pc T19 2pc - T20 4pc flametongue 193796 4636994 15441 3.92 192289 384688 19.6 19.6 23.0% 0.0% 0.0% 0.0% 15.63sec 4636994 300.31sec
T19 2pc - T20 4pc T19 2pc - T20 4pc flametongue_attack 10444 15840931 52749 181.37 14187 28378 907.8 907.8 23.0% 0.0% 0.0% 0.0% 0.60sec 15840931 300.31sec
T19 2pc - T20 4pc T19 2pc - T20 4pc flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.31sec
T19 2pc - T20 4pc T19 2pc - T20 4pc food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.31sec
T19 2pc - T20 4pc T19 2pc - T20 4pc frostbrand 196834 2741888 9130 3.76 118707 237386 18.8 18.8 22.9% 0.0% 0.0% 0.0% 16.28sec 2741888 300.31sec
T19 2pc - T20 4pc T19 2pc - T20 4pc hailstorm 210854 34754531 115731 179.18 31501 63008 896.8 896.8 23.0% 0.0% 0.0% 0.0% 0.60sec 34754531 300.31sec
T19 2pc - T20 4pc T19 2pc - T20 4pc lava_lash 60103 31376347 104481 7.63 663078 1328991 38.2 38.2 23.8% 0.0% 0.0% 0.0% 7.45sec 31376347 300.31sec
T19 2pc - T20 4pc T19 2pc - T20 4pc doom_vortex_ll 199116 3472562 11563 9.11 61842 123688 45.6 45.6 23.2% 0.0% 0.0% 0.0% 5.74sec 3472562 300.31sec
T19 2pc - T20 4pc T19 2pc - T20 4pc main_hand 0 5895253 19631 26.45 42783 85588 132.4 132.4 23.0% 18.9% 0.0% 0.0% 2.27sec 8666580 300.31sec
T19 2pc - T20 4pc T19 2pc - T20 4pc mark_of_the_hidden_satyr 191259 6489868 21611 4.10 257264 515352 20.5 20.5 22.9% 0.0% 0.0% 0.0% 14.61sec 6489868 300.31sec
T19 2pc - T20 4pc T19 2pc - T20 4pc offhand 1 2931933 9763 26.33 21409 42814 131.8 131.8 22.9% 19.0% 0.0% 0.0% 2.27sec 4310220 300.31sec
T19 2pc - T20 4pc T19 2pc - T20 4pc potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.31sec
T19 2pc - T20 4pc T19 2pc - T20 4pc rockbiter 193786 30406580 101252 11.17 440307 880946 55.9 55.9 23.5% 0.0% 0.0% 0.0% 5.31sec 30406580 300.31sec
T19 2pc - T20 4pc T19 2pc - T20 4pc specter_of_betrayal_driver 246461 0 0 0.00 0 0 7.2 0.0 0.0% 0.0% 0.0% 0.0% 45.25sec 0 300.31sec
T19 2pc - T20 4pc T19 2pc - T20 4pc stormlash 213307 11836141 39414 139.80 16915 0 699.7 699.7 0.0% 0.0% 0.0% 0.0% 1.08sec 11836141 300.31sec
T19 2pc - T20 4pc T19 2pc - T20 4pc stormstrike 17364 0 0 0.00 0 0 73.5 0.0 0.0% 0.0% 0.0% 0.0% 3.75sec 0 300.31sec
T19 2pc - T20 4pc T19 2pc - T20 4pc stormstrike_mh 32175 53007297 176511 18.38 365753 886622 92.0 92.0 40.4% 0.0% 0.0% 0.0% 3.75sec 77925747 300.31sec
T19 2pc - T20 4pc T19 2pc - T20 4pc stormstrike_offhand 32176 26542712 88386 18.38 182626 443780 92.0 92.0 40.6% 0.0% 0.0% 0.0% 3.75sec 39020301 300.31sec
T19 2pc - T20 4pc T19 2pc - T20 4pc unleash_lava 199053 14082631 46894 25.18 90883 181782 127.6 126.0 22.9% 0.0% 0.0% 0.0% 3.18sec 14082631 300.31sec
T19 2pc - T20 4pc T19 2pc - T20 4pc unleash_lightning 199054 14097210 46943 25.23 90881 181786 127.8 126.3 22.8% 0.0% 0.0% 0.0% 3.17sec 14097210 300.31sec
T19 2pc - T20 4pc T19 2pc - T20 4pc wind_lash 114089 4266218 14206 10.96 63209 126454 54.9 54.9 23.0% 0.0% 0.0% 0.0% 4.97sec 4266218 300.31sec
T19 2pc - T20 4pc T19 2pc - T20 4pc wind_lash_offhand 114093 2133371 7104 10.98 31604 63221 54.9 54.9 22.8% 0.0% 0.0% 0.0% 4.96sec 2133371 300.31sec
T19 2pc - T20 4pc T19 2pc - T20 4pc windfury_attack 25504 22009761 73291 36.67 97351 195775 183.5 183.5 22.9% 0.0% 0.0% 0.0% 3.32sec 32356434 300.31sec
T19 2pc - T20 4pc T19 2pc - T20 4pc windfury_attack_oh 33750 4416119 14705 7.66 93540 187155 38.3 38.3 23.1% 0.0% 0.0% 0.0% 14.87sec 6492113 300.31sec
T19 2pc - T20 4pc T19 2pc - T20 4pc windstrike 115356 0 0 0.00 0 0 54.7 0.0 0.0% 0.0% 0.0% 0.0% 4.98sec 0 300.31sec
T19 2pc - T20 4pc T19 2pc - T20 4pc windstrike_mh 115357 54728511 182243 13.67 531861 1260849 68.4 68.4 36.8% 0.0% 0.0% 0.0% 4.98sec 54728511 300.31sec
T19 2pc - T20 4pc T19 2pc - T20 4pc windstrike_offhand 115360 27337487 91032 13.67 265585 632234 68.4 68.4 36.5% 0.0% 0.0% 0.0% 4.98sec 27337487 300.31sec
T19 2pc - T20 4pc T19 2pc - T20 4pc_frost_wolf frozen_bite 224126 2729004 133838 24.10 269020 537633 8.2 8.2 23.9% 0.0% 0.0% 0.0% 30.16sec 2729004 20.39sec
T19 2pc - T20 4pc T19 2pc - T20 4pc_frost_wolf melee 0 1918716 94099 139.53 32782 65547 47.4 47.4 23.4% 0.0% 0.0% 0.0% 4.63sec 2820694 20.39sec
T19 2pc - T20 4pc T19 2pc - T20 4pc_frost_wolf snowstorm 198483 1277197 62637 42.18 72172 144226 14.3 14.3 23.5% 0.0% 0.0% 0.0% 15.28sec 1277197 20.39sec
T19 2pc - T20 4pc T19 2pc - T20 4pc_fiery_wolf fiery_jaws 224125 1795069 87514 23.68 179125 358655 8.1 8.1 23.7% 0.0% 0.0% 0.0% 29.95sec 4092999 20.51sec
T19 2pc - T20 4pc T19 2pc - T20 4pc_fiery_wolf fiery_jaws ticks -224125 2297931 7660 6.40 71831 0 8.1 32.0 0.0% 0.0% 0.0% 0.0% 29.95sec 4092999 20.51sec
T19 2pc - T20 4pc T19 2pc - T20 4pc_fiery_wolf fire_nova 198480 1254894 61179 41.21 72082 144178 14.1 14.1 23.6% 0.0% 0.0% 0.0% 15.13sec 1254894 20.51sec
T19 2pc - T20 4pc T19 2pc - T20 4pc_fiery_wolf melee 0 1896210 92445 137.34 32749 65505 47.0 47.0 23.3% 0.0% 0.0% 0.0% 4.58sec 2787609 20.51sec
T19 2pc - T20 4pc T19 2pc - T20 4pc_lightning_wolf crackling_surge 224127 0 0 0.00 0 0 8.3 0.0 0.0% 0.0% 0.0% 0.0% 30.56sec 0 21.30sec
T19 2pc - T20 4pc T19 2pc - T20 4pc_lightning_wolf melee 0 2688990 126226 134.79 45591 91320 47.9 47.9 23.2% 0.0% 0.0% 0.0% 4.65sec 3953070 21.30sec
T19 2pc - T20 4pc T19 2pc - T20 4pc_lightning_wolf thunder_bite 198485 1854625 87060 40.43 104269 208985 14.4 14.4 23.8% 0.0% 0.0% 0.0% 15.53sec 1854625 21.30sec
T19 4pc T19 4pc ascendance 114051 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.45sec 0 299.78sec
T19 4pc T19 4pc augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
T19 4pc T19 4pc berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 189.75sec 0 299.78sec
T19 4pc T19 4pc crash_lightning 187874 2361626 7878 2.11 189268 378609 10.5 10.5 18.5% 0.0% 0.0% 0.0% 27.20sec 2361626 299.78sec
T19 4pc T19 4pc crashing_storm 210801 1427252 4761 14.61 16502 33022 73.0 73.0 18.5% 0.0% 0.0% 0.0% 3.67sec 1427252 299.78sec
T19 4pc T19 4pc doom_winds 204945 0 0 0.00 0 0 5.3 0.0 0.0% 0.0% 0.0% 0.0% 61.72sec 0 299.78sec
T19 4pc T19 4pc dread_torrent 246464 11791433 39333 10.59 187692 375374 52.9 52.9 18.8% 0.0% 0.0% 0.0% 10.60sec 11791433 299.78sec
T19 4pc T19 4pc dread_torrent_driver 246463 0 0 0.00 0 0 28.4 0.0 0.0% 0.0% 0.0% 0.0% 10.60sec 0 299.78sec
T19 4pc T19 4pc feral_spirit 51533 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 121.13sec 0 299.78sec
T19 4pc T19 4pc flametongue 193796 4491239 14982 3.94 192340 384288 19.7 19.7 18.5% 0.0% 0.0% 0.0% 15.52sec 4491239 299.78sec
T19 4pc T19 4pc flametongue_attack 10444 15422135 51444 183.36 14189 28382 916.1 916.1 18.6% 0.0% 0.0% 0.0% 0.59sec 15422135 299.78sec
T19 4pc T19 4pc flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
T19 4pc T19 4pc food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
T19 4pc T19 4pc frostbrand 196834 2655337 8858 3.77 118672 237462 18.9 18.9 18.7% 0.0% 0.0% 0.0% 16.22sec 2655337 299.78sec
T19 4pc T19 4pc hailstorm 210854 33825769 112834 181.15 31503 63011 905.1 905.1 18.6% 0.0% 0.0% 0.0% 0.60sec 33825769 299.78sec
T19 4pc T19 4pc lava_lash 60103 32649163 108909 8.44 652797 1300516 42.2 42.2 18.7% 0.0% 0.0% 0.0% 6.74sec 32649163 299.78sec
T19 4pc T19 4pc doom_vortex_ll 199116 3670647 12244 10.02 61815 123588 50.1 50.1 18.6% 0.0% 0.0% 0.0% 5.24sec 3670647 299.78sec
T19 4pc T19 4pc main_hand 0 5669018 18910 26.63 42797 85567 133.1 133.1 18.5% 19.0% 0.0% 0.0% 2.26sec 8333993 299.78sec
T19 4pc T19 4pc mark_of_the_hidden_satyr 191259 6271962 20922 4.10 257265 514287 20.5 20.5 19.0% 0.0% 0.0% 0.0% 14.54sec 6271962 299.78sec
T19 4pc T19 4pc offhand 1 2828409 9435 26.53 21412 42819 132.5 132.5 18.7% 19.0% 0.0% 0.0% 2.25sec 4158029 299.78sec
T19 4pc T19 4pc potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.78sec
T19 4pc T19 4pc rockbiter 193786 29759048 99269 11.38 440359 880775 56.9 56.9 18.8% 0.0% 0.0% 0.0% 5.21sec 29759048 299.78sec
T19 4pc T19 4pc specter_of_betrayal_driver 246461 0 0 0.00 0 0 7.2 0.0 0.0% 0.0% 0.0% 0.0% 45.25sec 0 299.78sec
T19 4pc T19 4pc stormlash 213307 11393647 38006 140.01 16289 0 699.5 699.5 0.0% 0.0% 0.0% 0.0% 1.08sec 11393647 299.78sec
T19 4pc T19 4pc stormstrike 17364 0 0 0.00 0 0 77.7 0.0 0.0% 0.0% 0.0% 0.0% 3.56sec 0 299.78sec
T19 4pc T19 4pc stormstrike_mh 32175 54224223 180878 19.44 365767 892483 97.1 97.1 36.5% 0.0% 0.0% 0.0% 3.56sec 79714744 299.78sec
T19 4pc T19 4pc stormstrike_offhand 32176 27096256 90386 19.44 182988 445997 97.1 97.1 36.5% 0.0% 0.0% 0.0% 3.56sec 39834062 299.78sec
T19 4pc T19 4pc unleash_lava 199053 14219632 47433 26.39 90920 181788 133.4 131.9 18.6% 0.0% 0.0% 0.0% 3.05sec 14219632 299.78sec
T19 4pc T19 4pc unleash_lightning 199054 14159705 47233 26.28 90889 181827 132.9 131.3 18.7% 0.0% 0.0% 0.0% 3.06sec 14159705 299.78sec
T19 4pc T19 4pc wind_lash 114089 4125404 13761 11.01 63214 126405 55.0 55.0 18.6% 0.0% 0.0% 0.0% 4.90sec 4125404 299.78sec
T19 4pc T19 4pc wind_lash_offhand 114093 2064362 6886 11.02 31606 63205 55.0 55.0 18.7% 0.0% 0.0% 0.0% 4.90sec 2064362 299.78sec
T19 4pc T19 4pc windfury_attack 25504 21041853 70190 36.39 97582 195232 181.8 181.8 18.6% 0.0% 0.0% 0.0% 3.33sec 30933517 299.78sec
T19 4pc T19 4pc windfury_attack_oh 33750 4240817 14146 7.67 93598 187192 38.3 38.3 18.3% 0.0% 0.0% 0.0% 14.79sec 6234403 299.78sec
T19 4pc T19 4pc windstrike 115356 0 0 0.00 0 0 55.5 0.0 0.0% 0.0% 0.0% 0.0% 4.86sec 0 299.78sec
T19 4pc T19 4pc windstrike_mh 115357 53802338 179471 13.88 532701 1276590 69.4 69.4 32.7% 0.0% 0.0% 0.0% 4.86sec 53802338 299.78sec
T19 4pc T19 4pc windstrike_offhand 115360 26886037 89685 13.88 266449 638065 69.4 69.4 32.6% 0.0% 0.0% 0.0% 4.86sec 26886037 299.78sec
T19 4pc T19 4pc_frost_wolf frozen_bite 224126 2694466 128076 24.10 269022 536889 8.5 8.5 18.6% 0.0% 0.0% 0.0% 29.47sec 2694466 21.04sec
T19 4pc T19 4pc_frost_wolf melee 0 1907545 90671 139.95 32772 65523 49.1 49.1 18.6% 0.0% 0.0% 0.0% 4.49sec 2804271 21.04sec
T19 4pc T19 4pc_frost_wolf snowstorm 198483 1270232 60378 42.32 72159 144177 14.8 14.8 18.7% 0.0% 0.0% 0.0% 14.80sec 1270232 21.04sec
T19 4pc T19 4pc_fiery_wolf fiery_jaws 224125 1728322 86400 24.36 179400 358755 8.1 8.1 18.7% 0.0% 0.0% 0.0% 29.47sec 4033462 20.00sec
T19 4pc T19 4pc_fiery_wolf fiery_jaws ticks -224125 2305140 7684 6.42 71855 0 8.1 32.1 0.0% 0.0% 0.0% 0.0% 29.47sec 4033462 20.00sec
T19 4pc T19 4pc_fiery_wolf fire_nova 198480 1221084 61043 42.78 72164 144203 14.3 14.3 18.7% 0.0% 0.0% 0.0% 14.82sec 1221084 20.00sec
T19 4pc T19 4pc_fiery_wolf melee 0 1839898 91978 141.63 32789 65526 47.2 47.2 18.9% 0.0% 0.0% 0.0% 4.50sec 2704824 20.00sec
T19 4pc T19 4pc_lightning_wolf crackling_surge 224127 0 0 0.00 0 0 8.3 0.0 0.0% 0.0% 0.0% 0.0% 30.19sec 0 20.26sec
T19 4pc T19 4pc_lightning_wolf melee 0 2593307 127999 141.91 45623 91198 47.9 47.9 18.6% 0.0% 0.0% 0.0% 4.55sec 3812406 20.26sec
T19 4pc T19 4pc_lightning_wolf thunder_bite 198485 1771398 87432 42.50 104562 208585 14.4 14.4 18.1% 0.0% 0.0% 0.0% 14.95sec 1771398 20.26sec
T19 4pc - T20 2pc T19 4pc - T20 2pc ascendance 114051 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.30sec 0 300.72sec
T19 4pc - T20 2pc T19 4pc - T20 2pc augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.72sec
T19 4pc - T20 2pc T19 4pc - T20 2pc berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 189.92sec 0 300.72sec
T19 4pc - T20 2pc T19 4pc - T20 2pc crash_lightning 187874 4718008 15689 4.14 189109 378112 20.7 20.7 20.3% 0.0% 0.0% 0.0% 14.55sec 4718008 300.72sec
T19 4pc - T20 2pc T19 4pc - T20 2pc crashing_storm 210801 2931203 9747 28.69 16483 32975 143.8 143.8 23.7% 0.0% 0.0% 0.0% 2.04sec 2931203 300.72sec
T19 4pc - T20 2pc T19 4pc - T20 2pc doom_winds 204945 0 0 0.00 0 0 5.3 0.0 0.0% 0.0% 0.0% 0.0% 61.69sec 0 300.72sec
T19 4pc - T20 2pc T19 4pc - T20 2pc dread_torrent 246464 12200436 40571 10.57 187682 375442 53.0 53.0 22.6% 0.0% 0.0% 0.0% 10.60sec 12200436 300.72sec
T19 4pc - T20 2pc T19 4pc - T20 2pc dread_torrent_driver 246463 0 0 0.00 0 0 28.5 0.0 0.0% 0.0% 0.0% 0.0% 10.60sec 0 300.72sec
T19 4pc - T20 2pc T19 4pc - T20 2pc feral_spirit 51533 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 121.08sec 0 300.72sec
T19 4pc - T20 2pc T19 4pc - T20 2pc flametongue 193796 4625548 15382 3.90 192216 384372 19.5 19.5 23.2% 0.0% 0.0% 0.0% 15.71sec 4625548 300.72sec
T19 4pc - T20 2pc T19 4pc - T20 2pc flametongue_attack 10444 16033859 53318 183.41 14182 28371 919.2 919.2 23.0% 0.0% 0.0% 0.0% 0.59sec 16033859 300.72sec
T19 4pc - T20 2pc T19 4pc - T20 2pc flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.72sec
T19 4pc - T20 2pc T19 4pc - T20 2pc food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.72sec
T19 4pc - T20 2pc T19 4pc - T20 2pc frostbrand 196834 2732108 9085 3.75 118686 237136 18.8 18.8 22.6% 0.0% 0.0% 0.0% 16.32sec 2732108 300.72sec
T19 4pc - T20 2pc T19 4pc - T20 2pc hailstorm 210854 35167000 116943 181.19 31491 62991 908.1 908.1 23.0% 0.0% 0.0% 0.0% 0.60sec 35167000 300.72sec
T19 4pc - T20 2pc T19 4pc - T20 2pc lava_lash 60103 29792870 99072 7.05 682563 1359415 35.3 35.3 23.8% 0.0% 0.0% 0.0% 8.03sec 29792870 300.72sec
T19 4pc - T20 2pc T19 4pc - T20 2pc doom_vortex_ll 199116 3204336 10656 8.37 61834 123668 42.0 42.0 23.5% 0.0% 0.0% 0.0% 6.09sec 3204336 300.72sec
T19 4pc - T20 2pc T19 4pc - T20 2pc main_hand 0 5931994 19726 26.64 42775 85553 133.5 133.5 22.9% 19.0% 0.0% 0.0% 2.25sec 8720594 300.72sec
T19 4pc - T20 2pc T19 4pc - T20 2pc mark_of_the_hidden_satyr 191259 6482567 21557 4.10 257206 514369 20.6 20.6 22.6% 0.0% 0.0% 0.0% 14.59sec 6482567 300.72sec
T19 4pc - T20 2pc T19 4pc - T20 2pc offhand 1 2957912 9836 26.54 21400 42821 133.0 133.0 22.9% 19.0% 0.0% 0.0% 2.25sec 4348411 300.72sec
T19 4pc - T20 2pc T19 4pc - T20 2pc potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.72sec
T19 4pc - T20 2pc T19 4pc - T20 2pc rockbiter 193786 30016865 99817 11.03 440248 880833 55.3 55.3 23.4% 0.0% 0.0% 0.0% 5.39sec 30016865 300.72sec
T19 4pc - T20 2pc T19 4pc - T20 2pc specter_of_betrayal_driver 246461 0 0 0.00 0 0 7.2 0.0 0.0% 0.0% 0.0% 0.0% 45.25sec 0 300.72sec
T19 4pc - T20 2pc T19 4pc - T20 2pc stormlash 213307 11863905 39452 140.39 16861 0 703.6 703.6 0.0% 0.0% 0.0% 0.0% 1.08sec 11863905 300.72sec
T19 4pc - T20 2pc T19 4pc - T20 2pc stormstrike 17364 0 0 0.00 0 0 77.3 0.0 0.0% 0.0% 0.0% 0.0% 3.59sec 0 300.72sec
T19 4pc - T20 2pc T19 4pc - T20 2pc stormstrike_mh 32175 55993240 186198 19.26 365963 888418 96.5 96.5 41.0% 0.0% 0.0% 0.0% 3.59sec 82315367 300.72sec
T19 4pc - T20 2pc T19 4pc - T20 2pc stormstrike_offhand 32176 27961174 92981 19.26 183027 444417 96.5 96.5 40.8% 0.0% 0.0% 0.0% 3.59sec 41105574 300.72sec
T19 4pc - T20 2pc T19 4pc - T20 2pc unleash_lava 199053 14616147 48604 26.14 90836 181692 132.5 131.0 22.8% 0.0% 0.0% 0.0% 3.06sec 14616147 300.72sec
T19 4pc - T20 2pc T19 4pc - T20 2pc unleash_lightning 199054 14637051 48673 26.17 90819 181741 132.7 131.1 22.9% 0.0% 0.0% 0.0% 3.05sec 14637051 300.72sec
T19 4pc - T20 2pc T19 4pc - T20 2pc wind_lash 114089 4276875 14222 10.98 63194 126405 55.0 55.0 22.9% 0.0% 0.0% 0.0% 4.96sec 4276875 300.72sec
T19 4pc - T20 2pc T19 4pc - T20 2pc wind_lash_offhand 114093 2137051 7106 10.99 31595 63209 55.1 55.1 22.8% 0.0% 0.0% 0.0% 4.96sec 2137051 300.72sec
T19 4pc - T20 2pc T19 4pc - T20 2pc windfury_attack 25504 22263119 74033 37.21 96946 194613 186.5 186.5 23.0% 0.0% 0.0% 0.0% 3.26sec 32728893 300.72sec
T19 4pc - T20 2pc T19 4pc - T20 2pc windfury_attack_oh 33750 4415283 14682 7.64 93505 187155 38.3 38.3 23.2% 0.0% 0.0% 0.0% 14.85sec 6490884 300.72sec
T19 4pc - T20 2pc T19 4pc - T20 2pc windstrike 115356 0 0 0.00 0 0 55.5 0.0 0.0% 0.0% 0.0% 0.0% 4.90sec 0 300.72sec
T19 4pc - T20 2pc T19 4pc - T20 2pc windstrike_mh 115357 55647100 185047 13.86 531462 1266332 69.5 69.5 36.7% 0.0% 0.0% 0.0% 4.90sec 55647100 300.72sec
T19 4pc - T20 2pc T19 4pc - T20 2pc windstrike_offhand 115360 27795293 92429 13.86 266062 632209 69.5 69.5 36.6% 0.0% 0.0% 0.0% 4.90sec 27795293 300.72sec
T19 4pc - T20 2pc T19 4pc - T20 2pc_frost_wolf frozen_bite 224126 2711736 130100 23.48 268815 537600 8.2 8.2 23.7% 0.0% 0.0% 0.0% 30.02sec 2711736 20.84sec
T19 4pc - T20 2pc T19 4pc - T20 2pc_frost_wolf melee 0 1912902 91775 136.33 32755 65484 47.4 47.4 23.3% 0.0% 0.0% 0.0% 4.56sec 2812147 20.84sec
T19 4pc - T20 2pc T19 4pc - T20 2pc_frost_wolf snowstorm 198483 1267114 60792 41.05 72092 144138 14.3 14.3 23.3% 0.0% 0.0% 0.0% 15.15sec 1267114 20.84sec
T19 4pc - T20 2pc T19 4pc - T20 2pc_fiery_wolf fiery_jaws 224125 1831208 88509 24.09 179047 358736 8.3 8.3 23.0% 0.0% 0.0% 0.0% 29.62sec 4188676 20.69sec
T19 4pc - T20 2pc T19 4pc - T20 2pc_fiery_wolf fiery_jaws ticks -224125 2357468 7858 6.57 71754 0 8.3 32.9 0.0% 0.0% 0.0% 0.0% 29.62sec 4188676 20.69sec
T19 4pc - T20 2pc T19 4pc - T20 2pc_fiery_wolf fire_nova 198480 1292831 62487 42.05 72028 143908 14.5 14.5 23.8% 0.0% 0.0% 0.0% 15.05sec 1292831 20.69sec
T19 4pc - T20 2pc T19 4pc - T20 2pc_fiery_wolf melee 0 1948321 94169 140.02 32734 65473 48.3 48.3 23.3% 0.0% 0.0% 0.0% 4.55sec 2864216 20.69sec
T19 4pc - T20 2pc T19 4pc - T20 2pc_lightning_wolf crackling_surge 224127 0 0 0.00 0 0 8.4 0.0 0.0% 0.0% 0.0% 0.0% 29.73sec 0 20.94sec
T19 4pc - T20 2pc T19 4pc - T20 2pc_lightning_wolf melee 0 2749375 131276 139.84 45585 91279 48.8 48.8 23.5% 0.0% 0.0% 0.0% 4.48sec 4041842 20.94sec
T19 4pc - T20 2pc T19 4pc - T20 2pc_lightning_wolf thunder_bite 198485 1866944 89142 41.63 104368 208479 14.5 14.5 23.2% 0.0% 0.0% 0.0% 14.95sec 1866944 20.94sec
T20 2pc T20 2pc ascendance 114051 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.16sec 0 300.75sec
T20 2pc T20 2pc augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.75sec
T20 2pc T20 2pc berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 189.96sec 0 300.75sec
T20 2pc T20 2pc crash_lightning 187874 4862539 16168 4.26 189142 378440 21.3 21.3 20.5% 0.0% 0.0% 0.0% 14.22sec 4862539 300.75sec
T20 2pc T20 2pc crashing_storm 210801 3011228 10012 29.51 16492 32984 147.9 147.9 23.4% 0.0% 0.0% 0.0% 2.00sec 3011228 300.75sec
T20 2pc T20 2pc doom_winds 204945 0 0 0.00 0 0 5.3 0.0 0.0% 0.0% 0.0% 0.0% 61.70sec 0 300.75sec
T20 2pc T20 2pc dread_torrent 246464 12205736 40584 10.57 187685 375455 53.0 53.0 22.7% 0.0% 0.0% 0.0% 10.59sec 12205736 300.75sec
T20 2pc T20 2pc dread_torrent_driver 246463 0 0 0.00 0 0 28.5 0.0 0.0% 0.0% 0.0% 0.0% 10.59sec 0 300.75sec
T20 2pc T20 2pc feral_spirit 51533 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 121.14sec 0 300.75sec
T20 2pc T20 2pc flametongue 193796 4646950 15451 3.92 192240 384374 19.7 19.7 23.0% 0.0% 0.0% 0.0% 15.62sec 4646950 300.75sec
T20 2pc T20 2pc flametongue_attack 10444 15817241 52592 180.80 14187 28377 906.3 906.3 23.0% 0.0% 0.0% 0.0% 0.60sec 15817241 300.75sec
T20 2pc T20 2pc flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.75sec
T20 2pc T20 2pc food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.75sec
T20 2pc T20 2pc frostbrand 196834 2744454 9125 3.76 118655 237443 18.8 18.8 22.8% 0.0% 0.0% 0.0% 16.28sec 2744454 300.75sec
T20 2pc T20 2pc hailstorm 210854 34727096 115467 178.75 31500 63007 896.0 896.0 23.0% 0.0% 0.0% 0.0% 0.60sec 34727096 300.75sec
T20 2pc T20 2pc lava_lash 60103 31417361 104463 7.64 663657 1321314 38.3 38.3 23.9% 0.0% 0.0% 0.0% 7.45sec 31417361 300.75sec
T20 2pc T20 2pc doom_vortex_ll 199116 3475118 11555 9.11 61841 123692 45.7 45.7 23.1% 0.0% 0.0% 0.0% 5.75sec 3475118 300.75sec
T20 2pc T20 2pc main_hand 0 5928824 19713 26.57 42784 85559 133.2 133.2 23.0% 18.9% 0.0% 0.0% 2.26sec 8715933 300.75sec
T20 2pc T20 2pc mark_of_the_hidden_satyr 191259 6512232 21653 4.10 257166 514655 20.6 20.6 23.1% 0.0% 0.0% 0.0% 14.61sec 6512232 300.75sec
T20 2pc T20 2pc offhand 1 2954289 9823 26.46 21408 42806 132.6 132.6 23.0% 18.9% 0.0% 0.0% 2.26sec 4343084 300.75sec
T20 2pc T20 2pc potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.75sec
T20 2pc T20 2pc rockbiter 193786 30507142 101436 11.22 440221 880980 56.2 56.2 23.2% 0.0% 0.0% 0.0% 5.31sec 30507142 300.75sec
T20 2pc T20 2pc specter_of_betrayal_driver 246461 0 0 0.00 0 0 7.2 0.0 0.0% 0.0% 0.0% 0.0% 45.24sec 0 300.75sec
T20 2pc T20 2pc stormlash 213307 11784978 39185 138.99 16916 0 696.7 696.7 0.0% 0.0% 0.0% 0.0% 1.09sec 11784978 300.75sec
T20 2pc T20 2pc stormstrike 17364 0 0 0.00 0 0 73.8 0.0 0.0% 0.0% 0.0% 0.0% 3.76sec 0 300.75sec
T20 2pc T20 2pc stormstrike_mh 32175 48416888 160986 18.38 332551 808215 92.1 92.1 40.5% 0.0% 0.0% 0.0% 3.76sec 71177411 300.75sec
T20 2pc T20 2pc stormstrike_offhand 32176 24179342 80396 18.38 166545 403473 92.1 92.1 40.4% 0.0% 0.0% 0.0% 3.76sec 35545923 300.75sec
T20 2pc T20 2pc unleash_lava 199053 14011788 46589 25.03 90877 181831 127.0 125.5 22.9% 0.0% 0.0% 0.0% 3.18sec 14011788 300.75sec
T20 2pc T20 2pc unleash_lightning 199054 14050549 46718 25.10 90854 181758 127.3 125.8 22.9% 0.0% 0.0% 0.0% 3.18sec 14050549 300.75sec
T20 2pc T20 2pc wind_lash 114089 4227618 14057 10.84 63209 126485 54.3 54.3 23.1% 0.0% 0.0% 0.0% 4.96sec 4227618 300.75sec
T20 2pc T20 2pc wind_lash_offhand 114093 2113216 7026 10.84 31603 63237 54.3 54.3 23.1% 0.0% 0.0% 0.0% 4.96sec 2113216 300.75sec
T20 2pc T20 2pc windfury_attack 25504 21912431 72859 36.51 97214 195159 183.0 183.0 23.0% 0.0% 0.0% 0.0% 3.32sec 32213349 300.75sec
T20 2pc T20 2pc windfury_attack_oh 33750 4401306 14634 7.61 93596 187232 38.2 38.2 23.2% 0.0% 0.0% 0.0% 14.91sec 6470337 300.75sec
T20 2pc T20 2pc windstrike 115356 0 0 0.00 0 0 54.1 0.0 0.0% 0.0% 0.0% 0.0% 4.95sec 0 300.75sec
T20 2pc T20 2pc windstrike_mh 115357 49165089 163474 13.49 483592 1147928 67.6 67.6 36.6% 0.0% 0.0% 0.0% 4.95sec 49165089 300.75sec
T20 2pc T20 2pc windstrike_offhand 115360 24589622 81760 13.49 241656 574419 67.6 67.6 36.6% 0.0% 0.0% 0.0% 4.95sec 24589622 300.75sec
T20 2pc T20 2pc_frost_wolf frozen_bite 224126 2771686 132008 23.86 269133 536937 8.3 8.3 23.5% 0.0% 0.0% 0.0% 30.13sec 2771686 21.00sec
T20 2pc T20 2pc_frost_wolf melee 0 1954565 93090 138.07 32795 65587 48.3 48.3 23.4% 0.0% 0.0% 0.0% 4.65sec 2873396 21.00sec
T20 2pc T20 2pc_frost_wolf snowstorm 198483 1304564 62133 41.76 72147 144241 14.6 14.6 23.8% 0.0% 0.0% 0.0% 15.17sec 1304564 21.00sec
T20 2pc T20 2pc_fiery_wolf fiery_jaws 224125 1864896 89542 24.16 179133 359146 8.4 8.4 24.0% 0.0% 0.0% 0.0% 29.80sec 4243011 20.83sec
T20 2pc T20 2pc_fiery_wolf fiery_jaws ticks -224125 2378116 7927 6.62 71810 0 8.4 33.1 0.0% 0.0% 0.0% 0.0% 29.80sec 4243011 20.83sec
T20 2pc T20 2pc_fiery_wolf fire_nova 198480 1316011 63188 42.50 72115 144298 14.8 14.8 23.7% 0.0% 0.0% 0.0% 14.91sec 1316011 20.83sec
T20 2pc T20 2pc_fiery_wolf melee 0 1965302 94363 140.07 32783 65508 48.6 48.6 23.3% 0.0% 0.0% 0.0% 4.57sec 2889179 20.83sec
T20 2pc T20 2pc_lightning_wolf crackling_surge 224127 0 0 0.00 0 0 8.4 0.0 0.0% 0.0% 0.0% 0.0% 30.30sec 0 20.65sec
T20 2pc T20 2pc_lightning_wolf melee 0 2744439 132877 141.62 45635 91321 48.8 48.8 23.3% 0.0% 0.0% 0.0% 4.59sec 4034586 20.65sec
T20 2pc T20 2pc_lightning_wolf thunder_bite 198485 1894560 91728 42.62 104325 208974 14.7 14.7 23.7% 0.0% 0.0% 0.0% 15.05sec 1894560 20.65sec
T20 4pc T20 4pc ascendance 114051 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.34sec 0 300.56sec
T20 4pc T20 4pc augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.56sec
T20 4pc T20 4pc berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 189.80sec 0 300.56sec
T20 4pc T20 4pc crash_lightning 187874 16269897 54132 4.25 644328 1226654 21.3 21.3 20.7% 0.0% 0.0% 0.0% 14.26sec 16269897 300.56sec
T20 4pc T20 4pc crashing_storm 210801 3007922 10008 29.41 16496 32989 147.3 147.3 23.8% 0.0% 0.0% 0.0% 2.00sec 3007922 300.56sec
T20 4pc T20 4pc doom_winds 204945 0 0 0.00 0 0 5.3 0.0 0.0% 0.0% 0.0% 0.0% 61.73sec 0 300.56sec
T20 4pc T20 4pc dread_torrent 246464 12230990 40694 10.59 187683 375469 53.0 53.0 22.9% 0.0% 0.0% 0.0% 10.60sec 12230990 300.56sec
T20 4pc T20 4pc dread_torrent_driver 246463 0 0 0.00 0 0 28.5 0.0 0.0% 0.0% 0.0% 0.0% 10.60sec 0 300.56sec
T20 4pc T20 4pc feral_spirit 51533 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 121.16sec 0 300.56sec
T20 4pc T20 4pc flametongue 193796 4649576 15470 3.92 192322 384585 19.6 19.6 23.1% 0.0% 0.0% 0.0% 15.62sec 4649576 300.56sec
T20 4pc T20 4pc flametongue_attack 10444 15837457 52693 181.18 14187 28378 907.6 907.6 23.0% 0.0% 0.0% 0.0% 0.60sec 15837457 300.56sec
T20 4pc T20 4pc flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.56sec
T20 4pc T20 4pc food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.56sec
T20 4pc T20 4pc frostbrand 196834 2751636 9155 3.76 118733 237407 18.8 18.8 23.2% 0.0% 0.0% 0.0% 16.29sec 2751636 300.56sec
T20 4pc T20 4pc hailstorm 210854 34705134 115468 178.83 31501 63009 895.8 895.8 23.0% 0.0% 0.0% 0.0% 0.60sec 34705134 300.56sec
T20 4pc T20 4pc lava_lash 60103 31421501 104543 7.65 663682 1323101 38.3 38.3 23.7% 0.0% 0.0% 0.0% 7.44sec 31421501 300.56sec
T20 4pc T20 4pc doom_vortex_ll 199116 3499677 11644 9.17 61877 123728 45.9 45.9 23.1% 0.0% 0.0% 0.0% 5.71sec 3499677 300.56sec
T20 4pc T20 4pc main_hand 0 5914566 19678 26.55 42792 85593 133.0 133.0 23.0% 19.0% 0.0% 0.0% 2.27sec 8694972 300.56sec
T20 4pc T20 4pc mark_of_the_hidden_satyr 191259 6482309 21567 4.09 257310 515135 20.5 20.5 22.8% 0.0% 0.0% 0.0% 14.68sec 6482309 300.56sec
T20 4pc T20 4pc offhand 1 2948829 9811 26.44 21413 42818 132.4 132.4 22.9% 18.9% 0.0% 0.0% 2.27sec 4335059 300.56sec
T20 4pc T20 4pc potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.56sec
T20 4pc T20 4pc rockbiter 193786 30469569 101375 11.19 440446 881185 56.0 56.0 23.4% 0.0% 0.0% 0.0% 5.32sec 30469569 300.56sec
T20 4pc T20 4pc specter_of_betrayal_driver 246461 0 0 0.00 0 0 7.2 0.0 0.0% 0.0% 0.0% 0.0% 45.25sec 0 300.56sec
T20 4pc T20 4pc stormlash 213307 11839453 39391 139.51 16941 0 698.9 698.9 0.0% 0.0% 0.0% 0.0% 1.08sec 11839453 300.56sec
T20 4pc T20 4pc stormstrike 17364 0 0 0.00 0 0 73.7 0.0 0.0% 0.0% 0.0% 0.0% 3.77sec 0 300.56sec
T20 4pc T20 4pc stormstrike_mh 32175 48334181 160813 18.39 332641 807599 92.1 92.1 40.4% 0.0% 0.0% 0.0% 3.77sec 71055824 300.56sec
T20 4pc T20 4pc stormstrike_offhand 32176 24172745 80425 18.39 166468 403225 92.1 92.1 40.5% 0.0% 0.0% 0.0% 3.77sec 35536225 300.56sec
T20 4pc T20 4pc unleash_lava 199053 14009803 46612 25.04 90859 181794 127.0 125.5 22.9% 0.0% 0.0% 0.0% 3.18sec 14009803 300.56sec
T20 4pc T20 4pc unleash_lightning 199054 14014818 46629 25.06 90864 181793 127.0 125.5 22.9% 0.0% 0.0% 0.0% 3.18sec 14014818 300.56sec
T20 4pc T20 4pc wind_lash 114089 4224763 14056 10.86 63200 126433 54.4 54.4 22.8% 0.0% 0.0% 0.0% 4.92sec 4224763 300.56sec
T20 4pc T20 4pc wind_lash_offhand 114093 2116700 7042 10.87 31599 63216 54.4 54.4 23.1% 0.0% 0.0% 0.0% 4.92sec 2116700 300.56sec
T20 4pc T20 4pc windfury_attack 25504 21971897 73103 36.61 97295 195422 183.4 183.4 22.9% 0.0% 0.0% 0.0% 3.31sec 32300769 300.56sec
T20 4pc T20 4pc windfury_attack_oh 33750 4401439 14644 7.63 93547 187202 38.2 38.2 23.1% 0.0% 0.0% 0.0% 14.88sec 6470532 300.56sec
T20 4pc T20 4pc windstrike 115356 0 0 0.00 0 0 54.3 0.0 0.0% 0.0% 0.0% 0.0% 4.91sec 0 300.56sec
T20 4pc T20 4pc windstrike_mh 115357 49303266 164037 13.54 483418 1149167 67.8 67.8 36.6% 0.0% 0.0% 0.0% 4.91sec 49303266 300.56sec
T20 4pc T20 4pc windstrike_offhand 115360 24662620 82055 13.54 241973 573341 67.8 67.8 36.7% 0.0% 0.0% 0.0% 4.91sec 24662620 300.56sec
T20 4pc T20 4pc_frost_wolf frozen_bite 224126 2666212 130370 23.66 268927 538565 8.1 8.1 22.9% 0.0% 0.0% 0.0% 29.99sec 2666212 20.45sec
T20 4pc T20 4pc_frost_wolf melee 0 1898814 92847 137.44 32790 65572 46.8 46.8 23.6% 0.0% 0.0% 0.0% 4.58sec 2791436 20.45sec
T20 4pc T20 4pc_frost_wolf snowstorm 198483 1251858 61212 41.09 72158 144389 14.0 14.0 23.8% 0.0% 0.0% 0.0% 15.17sec 1251858 20.45sec
T20 4pc T20 4pc_fiery_wolf fiery_jaws 224125 1812512 86943 23.54 179146 358248 8.2 8.2 23.7% 0.0% 0.0% 0.0% 30.35sec 4135435 20.85sec
T20 4pc T20 4pc_fiery_wolf fiery_jaws ticks -224125 2322923 7743 6.47 71809 0 8.2 32.3 0.0% 0.0% 0.0% 0.0% 30.35sec 4135435 20.85sec
T20 4pc T20 4pc_fiery_wolf fire_nova 198480 1269470 60894 41.03 72098 144274 14.3 14.3 23.5% 0.0% 0.0% 0.0% 15.29sec 1269470 20.85sec
T20 4pc T20 4pc_fiery_wolf melee 0 1915546 91885 136.53 32769 65502 47.4 47.4 23.2% 0.0% 0.0% 0.0% 4.60sec 2816034 20.85sec
T20 4pc T20 4pc_lightning_wolf crackling_surge 224127 0 0 0.00 0 0 8.2 0.0 0.0% 0.0% 0.0% 0.0% 29.60sec 0 20.74sec
T20 4pc T20 4pc_lightning_wolf melee 0 2665149 128505 136.72 45617 91573 47.3 47.3 23.5% 0.0% 0.0% 0.0% 4.52sec 3918021 20.74sec
T20 4pc T20 4pc_lightning_wolf thunder_bite 198485 1828136 88147 40.96 104344 208707 14.2 14.2 23.7% 0.0% 0.0% 0.0% 14.80sec 1828136 20.74sec
baseline baseline ascendance 114051 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.06sec 0 299.94sec
baseline baseline augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
baseline baseline berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 189.96sec 0 299.94sec
baseline baseline crash_lightning 187874 2564987 8552 2.29 189274 378968 11.4 11.4 18.5% 0.0% 0.0% 0.0% 24.95sec 2564987 299.94sec
baseline baseline crashing_storm 210801 1549972 5168 15.84 16506 33027 79.2 79.2 18.6% 0.0% 0.0% 0.0% 3.39sec 1549972 299.94sec
baseline baseline doom_winds 204945 0 0 0.00 0 0 5.3 0.0 0.0% 0.0% 0.0% 0.0% 61.66sec 0 299.94sec
baseline baseline dread_torrent 246464 11782914 39284 10.58 187690 375373 52.9 52.9 18.7% 0.0% 0.0% 0.0% 10.60sec 11782914 299.94sec
baseline baseline dread_torrent_driver 246463 0 0 0.00 0 0 28.4 0.0 0.0% 0.0% 0.0% 0.0% 10.60sec 0 299.94sec
baseline baseline feral_spirit 51533 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 121.17sec 0 299.94sec
baseline baseline flametongue 193796 4517772 15062 3.96 192229 384628 19.8 19.8 18.7% 0.0% 0.0% 0.0% 15.44sec 4517772 299.94sec
baseline baseline flametongue_attack 10444 15209259 50707 180.82 14187 28376 903.9 903.9 18.6% 0.0% 0.0% 0.0% 0.60sec 15209259 299.94sec
baseline baseline flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
baseline baseline food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
baseline baseline frostbrand 196834 2660878 8871 3.78 118671 237496 18.9 18.9 18.7% 0.0% 0.0% 0.0% 16.19sec 2660878 299.94sec
baseline baseline hailstorm 210854 33353372 111198 178.55 31500 63008 892.6 892.6 18.6% 0.0% 0.0% 0.0% 0.60sec 33353372 299.94sec
baseline baseline lava_lash 60103 34264404 114236 9.09 636823 1273354 45.4 45.4 18.5% 0.0% 0.0% 0.0% 6.28sec 34264404 299.94sec
baseline baseline doom_vortex_ll 199116 3958416 13197 10.79 61832 123627 54.0 54.0 18.7% 0.0% 0.0% 0.0% 4.94sec 3958416 299.94sec
baseline baseline main_hand 0 5625119 18754 26.38 42789 85562 131.9 131.9 18.6% 18.9% 0.0% 0.0% 2.27sec 8269458 299.94sec
baseline baseline mark_of_the_hidden_satyr 191259 6271927 20910 4.11 257305 514179 20.5 20.5 18.7% 0.0% 0.0% 0.0% 14.59sec 6271927 299.94sec
baseline baseline offhand 1 2800782 9338 26.26 21409 42828 131.3 131.3 18.7% 19.0% 0.0% 0.0% 2.27sec 4117414 299.94sec
baseline baseline potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.94sec
baseline baseline rockbiter 193786 30090409 100320 11.53 440315 880989 57.6 57.6 18.6% 0.0% 0.0% 0.0% 5.15sec 30090409 299.94sec
baseline baseline specter_of_betrayal_driver 246461 0 0 0.00 0 0 7.2 0.0 0.0% 0.0% 0.0% 0.0% 45.25sec 0 299.94sec
baseline baseline stormlash 213307 11422302 38081 139.87 16337 0 699.2 699.2 0.0% 0.0% 0.0% 0.0% 1.08sec 11422302 299.94sec
baseline baseline stormstrike 17364 0 0 0.00 0 0 73.4 0.0 0.0% 0.0% 0.0% 0.0% 3.76sec 0 299.94sec
baseline baseline stormstrike_mh 32175 46256860 154218 18.34 332567 809535 91.7 91.7 36.0% 0.0% 0.0% 0.0% 3.76sec 68001966 299.94sec
baseline baseline stormstrike_offhand 32176 23116916 77071 18.34 166418 404328 91.7 91.7 36.0% 0.0% 0.0% 0.0% 3.76sec 33984056 299.94sec
baseline baseline unleash_lava 199053 13594748 45324 25.22 90886 181788 127.6 126.1 18.6% 0.0% 0.0% 0.0% 3.17sec 13594748 299.94sec
baseline baseline unleash_lightning 199054 13570471 45243 25.18 90878 181782 127.4 125.9 18.6% 0.0% 0.0% 0.0% 3.18sec 13570471 299.94sec
baseline baseline wind_lash 114089 4127359 13760 11.02 63211 126487 55.1 55.1 18.5% 0.0% 0.0% 0.0% 4.93sec 4127359 299.94sec
baseline baseline wind_lash_offhand 114093 2069476 6900 11.04 31611 63197 55.2 55.2 18.7% 0.0% 0.0% 0.0% 4.93sec 2069476 299.94sec
baseline baseline windfury_attack 25504 20854877 69529 35.92 97878 195739 179.6 179.6 18.7% 0.0% 0.0% 0.0% 3.39sec 30658644 299.94sec
baseline baseline windfury_attack_oh 33750 4220643 14071 7.61 93588 187213 38.1 38.1 18.5% 0.0% 0.0% 0.0% 14.86sec 6204745 299.94sec
baseline baseline windstrike 115356 0 0 0.00 0 0 54.8 0.0 0.0% 0.0% 0.0% 0.0% 4.96sec 0 299.94sec
baseline baseline windstrike_mh 115357 48055656 160215 13.68 484537 1159108 68.4 68.4 32.3% 0.0% 0.0% 0.0% 4.96sec 48055656 299.94sec
baseline baseline windstrike_offhand 115360 24054989 80198 13.68 242025 580296 68.4 68.4 32.4% 0.0% 0.0% 0.0% 4.96sec 24054989 299.94sec
baseline baseline_frost_wolf frozen_bite 224126 2582387 124173 23.40 268973 537304 8.1 8.1 18.4% 0.0% 0.0% 0.0% 30.18sec 2582387 20.80sec
baseline baseline_frost_wolf melee 0 1822890 87653 135.18 32772 65531 46.9 46.9 18.7% 0.0% 0.0% 0.0% 4.62sec 2679821 20.80sec
baseline baseline_frost_wolf snowstorm 198483 1224909 58899 41.30 72081 144129 14.3 14.3 18.7% 0.0% 0.0% 0.0% 15.03sec 1224909 20.80sec
baseline baseline_fiery_wolf fiery_jaws 224125 1749869 86215 24.32 179495 358681 8.2 8.2 18.5% 0.0% 0.0% 0.0% 30.28sec 4086653 20.30sec
baseline baseline_fiery_wolf fiery_jaws ticks -224125 2336784 7789 6.50 71906 0 8.2 32.5 0.0% 0.0% 0.0% 0.0% 30.28sec 4086653 20.30sec
baseline baseline_fiery_wolf fire_nova 198480 1250580 61615 43.18 72197 144507 14.6 14.6 18.6% 0.0% 0.0% 0.0% 15.01sec 1250580 20.30sec
baseline baseline_fiery_wolf melee 0 1860829 91682 141.51 32806 65651 47.9 47.9 18.5% 0.0% 0.0% 0.0% 4.59sec 2735595 20.30sec
baseline baseline_lightning_wolf crackling_surge 224127 0 0 0.00 0 0 8.4 0.0 0.0% 0.0% 0.0% 0.0% 29.93sec 0 20.39sec
baseline baseline_lightning_wolf melee 0 2628302 128923 142.96 45599 91221 48.6 48.6 18.7% 0.0% 0.0% 0.0% 4.54sec 3863853 20.39sec
baseline baseline_lightning_wolf thunder_bite 198485 1821418 89344 43.35 104257 208827 14.7 14.7 18.6% 0.0% 0.0% 0.0% 14.99sec 1821418 20.39sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
1324616.8 1324616.8 Health 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 11.30% 11.30% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:11.30%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 10.88% 10.88% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:10.88%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 10.32% 10.32% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:10.32%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 10.41% 10.41% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:10.41%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.60% 10.60% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.60%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 11.11% 11.11% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:11.11%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 11.50% 11.50% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:11.50%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 10.70% 10.70% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:10.70%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 7.88% 7.88% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:7.88%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 5.29% 5.29% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:5.29%

Trigger Attempt Success

  • trigger_pct:100.00%
Lashing Flames 5.6 124.1 7.5sec 0.3sec 14.21% 14.30% 7.6(7.6) 0.0

Buff details

  • buff initial source:T20 4pc
  • cooldown name:buff_lashing_flames
  • max_stacks:99
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02

Stack Uptimes

  • lashing_flames_1:1.04%
  • lashing_flames_2:1.05%
  • lashing_flames_3:0.43%
  • lashing_flames_4:0.54%
  • lashing_flames_5:0.40%
  • lashing_flames_6:0.31%
  • lashing_flames_7:0.32%
  • lashing_flames_8:0.27%
  • lashing_flames_9:0.28%
  • lashing_flames_10:0.25%
  • lashing_flames_11:0.26%
  • lashing_flames_12:0.25%
  • lashing_flames_13:0.24%
  • lashing_flames_14:0.25%
  • lashing_flames_15:0.22%
  • lashing_flames_16:0.23%
  • lashing_flames_17:0.22%
  • lashing_flames_18:0.21%
  • lashing_flames_19:0.21%
  • lashing_flames_20:0.20%
  • lashing_flames_21:0.19%
  • lashing_flames_22:0.19%
  • lashing_flames_23:0.18%
  • lashing_flames_24:0.18%
  • lashing_flames_25:0.17%
  • lashing_flames_26:0.17%
  • lashing_flames_27:0.16%
  • lashing_flames_28:0.16%
  • lashing_flames_29:0.15%
  • lashing_flames_30:0.15%
  • lashing_flames_31:0.15%
  • lashing_flames_32:0.14%
  • lashing_flames_33:0.14%
  • lashing_flames_34:0.13%
  • lashing_flames_35:0.13%
  • lashing_flames_36:0.13%
  • lashing_flames_37:0.12%
  • lashing_flames_38:0.12%
  • lashing_flames_39:0.12%
  • lashing_flames_40:0.11%
  • lashing_flames_41:0.11%
  • lashing_flames_42:0.11%
  • lashing_flames_43:0.10%
  • lashing_flames_44:0.10%
  • lashing_flames_45:0.10%
  • lashing_flames_46:0.09%
  • lashing_flames_47:0.09%
  • lashing_flames_48:0.09%
  • lashing_flames_49:0.09%
  • lashing_flames_50:0.08%
  • lashing_flames_51:0.08%
  • lashing_flames_52:0.08%
  • lashing_flames_53:0.08%
  • lashing_flames_54:0.08%
  • lashing_flames_55:0.07%
  • lashing_flames_56:0.07%
  • lashing_flames_57:0.07%
  • lashing_flames_58:0.07%
  • lashing_flames_59:0.07%
  • lashing_flames_60:0.07%
  • lashing_flames_61:0.06%
  • lashing_flames_62:0.06%
  • lashing_flames_63:0.06%
  • lashing_flames_64:0.06%
  • lashing_flames_65:0.06%
  • lashing_flames_66:0.05%
  • lashing_flames_67:0.05%
  • lashing_flames_68:0.05%
  • lashing_flames_69:0.05%
  • lashing_flames_70:0.05%
  • lashing_flames_71:0.05%
  • lashing_flames_72:0.05%
  • lashing_flames_73:0.05%
  • lashing_flames_74:0.04%
  • lashing_flames_75:0.04%
  • lashing_flames_76:0.04%
  • lashing_flames_77:0.04%
  • lashing_flames_78:0.04%
  • lashing_flames_79:0.04%
  • lashing_flames_80:0.04%
  • lashing_flames_81:0.04%
  • lashing_flames_82:0.04%
  • lashing_flames_83:0.04%
  • lashing_flames_84:0.03%
  • lashing_flames_85:0.03%
  • lashing_flames_86:0.03%
  • lashing_flames_87:0.03%
  • lashing_flames_88:0.03%
  • lashing_flames_89:0.03%
  • lashing_flames_90:0.03%
  • lashing_flames_91:0.03%
  • lashing_flames_92:0.03%
  • lashing_flames_93:0.03%
  • lashing_flames_94:0.03%
  • lashing_flames_95:0.03%
  • lashing_flames_96:0.02%
  • lashing_flames_97:0.03%
  • lashing_flames_98:0.03%
  • lashing_flames_99:0.83%

Trigger Attempt Success

  • trigger_pct:14.30%

Spelldata details

  • id:240842
  • name:Lashing Flames
  • tooltip:Damage taken from the Shaman's next Lava Lash increased by $w1%.
  • description:{$@spelldesc238142=Your Flametongue damage causes the target to take $240842s1% increased damage from your next Lava Lash. This effect stacks.}
  • max_stacks:99
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Lashing Flames 6.5 144.5 7.5sec 0.3sec 16.56% 16.67% 8.7(8.7) 0.0

Buff details

  • buff initial source:T20 2pc
  • cooldown name:buff_lashing_flames
  • max_stacks:99
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02

Stack Uptimes

  • lashing_flames_1:1.22%
  • lashing_flames_2:1.22%
  • lashing_flames_3:0.50%
  • lashing_flames_4:0.62%
  • lashing_flames_5:0.47%
  • lashing_flames_6:0.36%
  • lashing_flames_7:0.37%
  • lashing_flames_8:0.31%
  • lashing_flames_9:0.32%
  • lashing_flames_10:0.29%
  • lashing_flames_11:0.30%
  • lashing_flames_12:0.29%
  • lashing_flames_13:0.28%
  • lashing_flames_14:0.28%
  • lashing_flames_15:0.27%
  • lashing_flames_16:0.27%
  • lashing_flames_17:0.25%
  • lashing_flames_18:0.24%
  • lashing_flames_19:0.24%
  • lashing_flames_20:0.23%
  • lashing_flames_21:0.23%
  • lashing_flames_22:0.22%
  • lashing_flames_23:0.21%
  • lashing_flames_24:0.21%
  • lashing_flames_25:0.20%
  • lashing_flames_26:0.20%
  • lashing_flames_27:0.19%
  • lashing_flames_28:0.18%
  • lashing_flames_29:0.18%
  • lashing_flames_30:0.18%
  • lashing_flames_31:0.17%
  • lashing_flames_32:0.17%
  • lashing_flames_33:0.16%
  • lashing_flames_34:0.16%
  • lashing_flames_35:0.15%
  • lashing_flames_36:0.15%
  • lashing_flames_37:0.14%
  • lashing_flames_38:0.14%
  • lashing_flames_39:0.14%
  • lashing_flames_40:0.13%
  • lashing_flames_41:0.13%
  • lashing_flames_42:0.12%
  • lashing_flames_43:0.12%
  • lashing_flames_44:0.12%
  • lashing_flames_45:0.12%
  • lashing_flames_46:0.11%
  • lashing_flames_47:0.11%
  • lashing_flames_48:0.11%
  • lashing_flames_49:0.10%
  • lashing_flames_50:0.10%
  • lashing_flames_51:0.10%
  • lashing_flames_52:0.09%
  • lashing_flames_53:0.09%
  • lashing_flames_54:0.09%
  • lashing_flames_55:0.09%
  • lashing_flames_56:0.09%
  • lashing_flames_57:0.08%
  • lashing_flames_58:0.08%
  • lashing_flames_59:0.08%
  • lashing_flames_60:0.08%
  • lashing_flames_61:0.07%
  • lashing_flames_62:0.07%
  • lashing_flames_63:0.07%
  • lashing_flames_64:0.07%
  • lashing_flames_65:0.07%
  • lashing_flames_66:0.06%
  • lashing_flames_67:0.06%
  • lashing_flames_68:0.06%
  • lashing_flames_69:0.06%
  • lashing_flames_70:0.06%
  • lashing_flames_71:0.06%
  • lashing_flames_72:0.05%
  • lashing_flames_73:0.05%
  • lashing_flames_74:0.05%
  • lashing_flames_75:0.05%
  • lashing_flames_76:0.05%
  • lashing_flames_77:0.05%
  • lashing_flames_78:0.05%
  • lashing_flames_79:0.05%
  • lashing_flames_80:0.04%
  • lashing_flames_81:0.04%
  • lashing_flames_82:0.04%
  • lashing_flames_83:0.04%
  • lashing_flames_84:0.04%
  • lashing_flames_85:0.04%
  • lashing_flames_86:0.04%
  • lashing_flames_87:0.04%
  • lashing_flames_88:0.04%
  • lashing_flames_89:0.04%
  • lashing_flames_90:0.03%
  • lashing_flames_91:0.03%
  • lashing_flames_92:0.03%
  • lashing_flames_93:0.03%
  • lashing_flames_94:0.03%
  • lashing_flames_95:0.03%
  • lashing_flames_96:0.03%
  • lashing_flames_97:0.03%
  • lashing_flames_98:0.03%
  • lashing_flames_99:0.95%

Trigger Attempt Success

  • trigger_pct:16.67%

Spelldata details

  • id:240842
  • name:Lashing Flames
  • tooltip:Damage taken from the Shaman's next Lava Lash increased by $w1%.
  • description:{$@spelldesc238142=Your Flametongue damage causes the target to take $240842s1% increased damage from your next Lava Lash. This effect stacks.}
  • max_stacks:99
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Lashing Flames 7.8 173.7 7.5sec 0.3sec 19.87% 20.00% 10.8(10.8) 0.0

Buff details

  • buff initial source:T19 2pc - T20 4pc
  • cooldown name:buff_lashing_flames
  • max_stacks:99
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02

Stack Uptimes

  • lashing_flames_1:1.46%
  • lashing_flames_2:1.47%
  • lashing_flames_3:0.60%
  • lashing_flames_4:0.74%
  • lashing_flames_5:0.56%
  • lashing_flames_6:0.43%
  • lashing_flames_7:0.44%
  • lashing_flames_8:0.37%
  • lashing_flames_9:0.39%
  • lashing_flames_10:0.35%
  • lashing_flames_11:0.35%
  • lashing_flames_12:0.35%
  • lashing_flames_13:0.34%
  • lashing_flames_14:0.34%
  • lashing_flames_15:0.32%
  • lashing_flames_16:0.32%
  • lashing_flames_17:0.31%
  • lashing_flames_18:0.29%
  • lashing_flames_19:0.29%
  • lashing_flames_20:0.27%
  • lashing_flames_21:0.27%
  • lashing_flames_22:0.27%
  • lashing_flames_23:0.26%
  • lashing_flames_24:0.25%
  • lashing_flames_25:0.24%
  • lashing_flames_26:0.24%
  • lashing_flames_27:0.23%
  • lashing_flames_28:0.22%
  • lashing_flames_29:0.22%
  • lashing_flames_30:0.21%
  • lashing_flames_31:0.20%
  • lashing_flames_32:0.20%
  • lashing_flames_33:0.20%
  • lashing_flames_34:0.19%
  • lashing_flames_35:0.18%
  • lashing_flames_36:0.18%
  • lashing_flames_37:0.17%
  • lashing_flames_38:0.16%
  • lashing_flames_39:0.16%
  • lashing_flames_40:0.16%
  • lashing_flames_41:0.15%
  • lashing_flames_42:0.15%
  • lashing_flames_43:0.14%
  • lashing_flames_44:0.14%
  • lashing_flames_45:0.14%
  • lashing_flames_46:0.13%
  • lashing_flames_47:0.13%
  • lashing_flames_48:0.13%
  • lashing_flames_49:0.12%
  • lashing_flames_50:0.12%
  • lashing_flames_51:0.11%
  • lashing_flames_52:0.11%
  • lashing_flames_53:0.11%
  • lashing_flames_54:0.11%
  • lashing_flames_55:0.10%
  • lashing_flames_56:0.10%
  • lashing_flames_57:0.09%
  • lashing_flames_58:0.10%
  • lashing_flames_59:0.09%
  • lashing_flames_60:0.09%
  • lashing_flames_61:0.09%
  • lashing_flames_62:0.09%
  • lashing_flames_63:0.08%
  • lashing_flames_64:0.08%
  • lashing_flames_65:0.08%
  • lashing_flames_66:0.07%
  • lashing_flames_67:0.08%
  • lashing_flames_68:0.07%
  • lashing_flames_69:0.07%
  • lashing_flames_70:0.07%
  • lashing_flames_71:0.07%
  • lashing_flames_72:0.07%
  • lashing_flames_73:0.07%
  • lashing_flames_74:0.06%
  • lashing_flames_75:0.06%
  • lashing_flames_76:0.06%
  • lashing_flames_77:0.06%
  • lashing_flames_78:0.06%
  • lashing_flames_79:0.06%
  • lashing_flames_80:0.05%
  • lashing_flames_81:0.05%
  • lashing_flames_82:0.05%
  • lashing_flames_83:0.05%
  • lashing_flames_84:0.05%
  • lashing_flames_85:0.05%
  • lashing_flames_86:0.05%
  • lashing_flames_87:0.05%
  • lashing_flames_88:0.04%
  • lashing_flames_89:0.04%
  • lashing_flames_90:0.04%
  • lashing_flames_91:0.04%
  • lashing_flames_92:0.04%
  • lashing_flames_93:0.04%
  • lashing_flames_94:0.04%
  • lashing_flames_95:0.04%
  • lashing_flames_96:0.04%
  • lashing_flames_97:0.04%
  • lashing_flames_98:0.03%
  • lashing_flames_99:1.16%

Trigger Attempt Success

  • trigger_pct:20.00%

Spelldata details

  • id:240842
  • name:Lashing Flames
  • tooltip:Damage taken from the Shaman's next Lava Lash increased by $w1%.
  • description:{$@spelldesc238142=Your Flametongue damage causes the target to take $240842s1% increased damage from your next Lava Lash. This effect stacks.}
  • max_stacks:99
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Lashing Flames 9.1 220.7 8.2sec 0.3sec 24.84% 25.00% 14.1(14.1) 0.0

Buff details

  • buff initial source:T19 4pc - T20 2pc
  • cooldown name:buff_lashing_flames
  • max_stacks:99
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02

Stack Uptimes

  • lashing_flames_1:1.66%
  • lashing_flames_2:1.66%
  • lashing_flames_3:0.65%
  • lashing_flames_4:0.86%
  • lashing_flames_5:0.67%
  • lashing_flames_6:0.50%
  • lashing_flames_7:0.53%
  • lashing_flames_8:0.45%
  • lashing_flames_9:0.48%
  • lashing_flames_10:0.44%
  • lashing_flames_11:0.46%
  • lashing_flames_12:0.45%
  • lashing_flames_13:0.44%
  • lashing_flames_14:0.44%
  • lashing_flames_15:0.41%
  • lashing_flames_16:0.41%
  • lashing_flames_17:0.40%
  • lashing_flames_18:0.38%
  • lashing_flames_19:0.37%
  • lashing_flames_20:0.35%
  • lashing_flames_21:0.35%
  • lashing_flames_22:0.35%
  • lashing_flames_23:0.33%
  • lashing_flames_24:0.32%
  • lashing_flames_25:0.31%
  • lashing_flames_26:0.30%
  • lashing_flames_27:0.30%
  • lashing_flames_28:0.29%
  • lashing_flames_29:0.28%
  • lashing_flames_30:0.27%
  • lashing_flames_31:0.27%
  • lashing_flames_32:0.26%
  • lashing_flames_33:0.25%
  • lashing_flames_34:0.24%
  • lashing_flames_35:0.23%
  • lashing_flames_36:0.23%
  • lashing_flames_37:0.23%
  • lashing_flames_38:0.22%
  • lashing_flames_39:0.21%
  • lashing_flames_40:0.20%
  • lashing_flames_41:0.20%
  • lashing_flames_42:0.19%
  • lashing_flames_43:0.19%
  • lashing_flames_44:0.19%
  • lashing_flames_45:0.18%
  • lashing_flames_46:0.17%
  • lashing_flames_47:0.16%
  • lashing_flames_48:0.16%
  • lashing_flames_49:0.16%
  • lashing_flames_50:0.15%
  • lashing_flames_51:0.15%
  • lashing_flames_52:0.14%
  • lashing_flames_53:0.14%
  • lashing_flames_54:0.13%
  • lashing_flames_55:0.13%
  • lashing_flames_56:0.13%
  • lashing_flames_57:0.12%
  • lashing_flames_58:0.12%
  • lashing_flames_59:0.12%
  • lashing_flames_60:0.11%
  • lashing_flames_61:0.11%
  • lashing_flames_62:0.11%
  • lashing_flames_63:0.10%
  • lashing_flames_64:0.11%
  • lashing_flames_65:0.10%
  • lashing_flames_66:0.10%
  • lashing_flames_67:0.09%
  • lashing_flames_68:0.09%
  • lashing_flames_69:0.09%
  • lashing_flames_70:0.09%
  • lashing_flames_71:0.09%
  • lashing_flames_72:0.09%
  • lashing_flames_73:0.08%
  • lashing_flames_74:0.08%
  • lashing_flames_75:0.08%
  • lashing_flames_76:0.08%
  • lashing_flames_77:0.08%
  • lashing_flames_78:0.07%
  • lashing_flames_79:0.07%
  • lashing_flames_80:0.07%
  • lashing_flames_81:0.07%
  • lashing_flames_82:0.07%
  • lashing_flames_83:0.07%
  • lashing_flames_84:0.06%
  • lashing_flames_85:0.06%
  • lashing_flames_86:0.06%
  • lashing_flames_87:0.06%
  • lashing_flames_88:0.06%
  • lashing_flames_89:0.06%
  • lashing_flames_90:0.05%
  • lashing_flames_91:0.05%
  • lashing_flames_92:0.05%
  • lashing_flames_93:0.05%
  • lashing_flames_94:0.05%
  • lashing_flames_95:0.05%
  • lashing_flames_96:0.05%
  • lashing_flames_97:0.05%
  • lashing_flames_98:0.04%
  • lashing_flames_99:1.53%

Trigger Attempt Success

  • trigger_pct:25.00%

Spelldata details

  • id:240842
  • name:Lashing Flames
  • tooltip:Damage taken from the Shaman's next Lava Lash increased by $w1%.
  • description:{$@spelldesc238142=Your Flametongue damage causes the target to take $240842s1% increased damage from your next Lava Lash. This effect stacks.}
  • max_stacks:99
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Lashing Flames 14.4 291.0 6.9sec 0.3sec 33.12% 33.33% 10.2(10.2) 0.0

Buff details

  • buff initial source:T19 4pc
  • cooldown name:buff_lashing_flames
  • max_stacks:99
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02

Stack Uptimes

  • lashing_flames_1:2.63%
  • lashing_flames_2:2.69%
  • lashing_flames_3:1.03%
  • lashing_flames_4:1.27%
  • lashing_flames_5:0.99%
  • lashing_flames_6:0.73%
  • lashing_flames_7:0.79%
  • lashing_flames_8:0.67%
  • lashing_flames_9:0.74%
  • lashing_flames_10:0.67%
  • lashing_flames_11:0.69%
  • lashing_flames_12:0.69%
  • lashing_flames_13:0.65%
  • lashing_flames_14:0.64%
  • lashing_flames_15:0.59%
  • lashing_flames_16:0.59%
  • lashing_flames_17:0.57%
  • lashing_flames_18:0.53%
  • lashing_flames_19:0.53%
  • lashing_flames_20:0.50%
  • lashing_flames_21:0.50%
  • lashing_flames_22:0.48%
  • lashing_flames_23:0.46%
  • lashing_flames_24:0.45%
  • lashing_flames_25:0.42%
  • lashing_flames_26:0.41%
  • lashing_flames_27:0.41%
  • lashing_flames_28:0.39%
  • lashing_flames_29:0.37%
  • lashing_flames_30:0.36%
  • lashing_flames_31:0.35%
  • lashing_flames_32:0.34%
  • lashing_flames_33:0.33%
  • lashing_flames_34:0.32%
  • lashing_flames_35:0.30%
  • lashing_flames_36:0.30%
  • lashing_flames_37:0.29%
  • lashing_flames_38:0.28%
  • lashing_flames_39:0.27%
  • lashing_flames_40:0.26%
  • lashing_flames_41:0.25%
  • lashing_flames_42:0.24%
  • lashing_flames_43:0.24%
  • lashing_flames_44:0.23%
  • lashing_flames_45:0.22%
  • lashing_flames_46:0.21%
  • lashing_flames_47:0.20%
  • lashing_flames_48:0.20%
  • lashing_flames_49:0.19%
  • lashing_flames_50:0.18%
  • lashing_flames_51:0.18%
  • lashing_flames_52:0.17%
  • lashing_flames_53:0.16%
  • lashing_flames_54:0.16%
  • lashing_flames_55:0.15%
  • lashing_flames_56:0.15%
  • lashing_flames_57:0.15%
  • lashing_flames_58:0.14%
  • lashing_flames_59:0.13%
  • lashing_flames_60:0.13%
  • lashing_flames_61:0.13%
  • lashing_flames_62:0.12%
  • lashing_flames_63:0.12%
  • lashing_flames_64:0.11%
  • lashing_flames_65:0.11%
  • lashing_flames_66:0.11%
  • lashing_flames_67:0.11%
  • lashing_flames_68:0.10%
  • lashing_flames_69:0.10%
  • lashing_flames_70:0.10%
  • lashing_flames_71:0.09%
  • lashing_flames_72:0.09%
  • lashing_flames_73:0.09%
  • lashing_flames_74:0.09%
  • lashing_flames_75:0.08%
  • lashing_flames_76:0.08%
  • lashing_flames_77:0.08%
  • lashing_flames_78:0.07%
  • lashing_flames_79:0.07%
  • lashing_flames_80:0.07%
  • lashing_flames_81:0.07%
  • lashing_flames_82:0.07%
  • lashing_flames_83:0.06%
  • lashing_flames_84:0.06%
  • lashing_flames_85:0.06%
  • lashing_flames_86:0.06%
  • lashing_flames_87:0.06%
  • lashing_flames_88:0.05%
  • lashing_flames_89:0.05%
  • lashing_flames_90:0.05%
  • lashing_flames_91:0.05%
  • lashing_flames_92:0.05%
  • lashing_flames_93:0.05%
  • lashing_flames_94:0.05%
  • lashing_flames_95:0.05%
  • lashing_flames_96:0.04%
  • lashing_flames_97:0.04%
  • lashing_flames_98:0.04%
  • lashing_flames_99:1.08%

Trigger Attempt Success

  • trigger_pct:33.33%

Spelldata details

  • id:240842
  • name:Lashing Flames
  • tooltip:Damage taken from the Shaman's next Lava Lash increased by $w1%.
  • description:{$@spelldesc238142=Your Flametongue damage causes the target to take $240842s1% increased damage from your next Lava Lash. This effect stacks.}
  • max_stacks:99
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Lashing Flames 23.2 428.8 6.4sec 0.3sec 49.69% 50.00% 14.9(14.9) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_lashing_flames
  • max_stacks:99
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02

Stack Uptimes

  • lashing_flames_1:4.31%
  • lashing_flames_2:4.45%
  • lashing_flames_3:1.74%
  • lashing_flames_4:2.03%
  • lashing_flames_5:1.53%
  • lashing_flames_6:1.16%
  • lashing_flames_7:1.21%
  • lashing_flames_8:1.00%
  • lashing_flames_9:1.09%
  • lashing_flames_10:0.97%
  • lashing_flames_11:0.99%
  • lashing_flames_12:0.98%
  • lashing_flames_13:0.92%
  • lashing_flames_14:0.91%
  • lashing_flames_15:0.85%
  • lashing_flames_16:0.84%
  • lashing_flames_17:0.82%
  • lashing_flames_18:0.78%
  • lashing_flames_19:0.77%
  • lashing_flames_20:0.72%
  • lashing_flames_21:0.72%
  • lashing_flames_22:0.69%
  • lashing_flames_23:0.66%
  • lashing_flames_24:0.64%
  • lashing_flames_25:0.62%
  • lashing_flames_26:0.60%
  • lashing_flames_27:0.58%
  • lashing_flames_28:0.56%
  • lashing_flames_29:0.55%
  • lashing_flames_30:0.53%
  • lashing_flames_31:0.51%
  • lashing_flames_32:0.49%
  • lashing_flames_33:0.47%
  • lashing_flames_34:0.45%
  • lashing_flames_35:0.45%
  • lashing_flames_36:0.43%
  • lashing_flames_37:0.41%
  • lashing_flames_38:0.40%
  • lashing_flames_39:0.38%
  • lashing_flames_40:0.37%
  • lashing_flames_41:0.36%
  • lashing_flames_42:0.35%
  • lashing_flames_43:0.33%
  • lashing_flames_44:0.32%
  • lashing_flames_45:0.32%
  • lashing_flames_46:0.30%
  • lashing_flames_47:0.29%
  • lashing_flames_48:0.29%
  • lashing_flames_49:0.27%
  • lashing_flames_50:0.26%
  • lashing_flames_51:0.26%
  • lashing_flames_52:0.25%
  • lashing_flames_53:0.24%
  • lashing_flames_54:0.23%
  • lashing_flames_55:0.22%
  • lashing_flames_56:0.21%
  • lashing_flames_57:0.21%
  • lashing_flames_58:0.21%
  • lashing_flames_59:0.20%
  • lashing_flames_60:0.19%
  • lashing_flames_61:0.19%
  • lashing_flames_62:0.17%
  • lashing_flames_63:0.17%
  • lashing_flames_64:0.17%
  • lashing_flames_65:0.16%
  • lashing_flames_66:0.16%
  • lashing_flames_67:0.15%
  • lashing_flames_68:0.15%
  • lashing_flames_69:0.14%
  • lashing_flames_70:0.14%
  • lashing_flames_71:0.13%
  • lashing_flames_72:0.13%
  • lashing_flames_73:0.12%
  • lashing_flames_74:0.12%
  • lashing_flames_75:0.12%
  • lashing_flames_76:0.12%
  • lashing_flames_77:0.11%
  • lashing_flames_78:0.11%
  • lashing_flames_79:0.10%
  • lashing_flames_80:0.10%
  • lashing_flames_81:0.10%
  • lashing_flames_82:0.10%
  • lashing_flames_83:0.09%
  • lashing_flames_84:0.09%
  • lashing_flames_85:0.09%
  • lashing_flames_86:0.08%
  • lashing_flames_87:0.09%
  • lashing_flames_88:0.08%
  • lashing_flames_89:0.08%
  • lashing_flames_90:0.08%
  • lashing_flames_91:0.08%
  • lashing_flames_92:0.07%
  • lashing_flames_93:0.07%
  • lashing_flames_94:0.07%
  • lashing_flames_95:0.07%
  • lashing_flames_96:0.06%
  • lashing_flames_97:0.06%
  • lashing_flames_98:0.06%
  • lashing_flames_99:1.59%

Trigger Attempt Success

  • trigger_pct:50.00%

Spelldata details

  • id:240842
  • name:Lashing Flames
  • tooltip:Damage taken from the Shaman's next Lava Lash increased by $w1%.
  • description:{$@spelldesc238142=Your Flametongue damage causes the target to take $240842s1% increased damage from your next Lava Lash. This effect stacks.}
  • max_stacks:99
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Lashing Flames 46.4 856.9 6.4sec 0.3sec 99.38% 100.00% 29.7(29.7) 0.0

Buff details

  • buff initial source:T19 2pc
  • cooldown name:buff_lashing_flames
  • max_stacks:99
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02

Stack Uptimes

  • lashing_flames_1:8.62%
  • lashing_flames_2:8.91%
  • lashing_flames_3:3.49%
  • lashing_flames_4:4.10%
  • lashing_flames_5:3.06%
  • lashing_flames_6:2.32%
  • lashing_flames_7:2.38%
  • lashing_flames_8:2.03%
  • lashing_flames_9:2.17%
  • lashing_flames_10:1.91%
  • lashing_flames_11:1.98%
  • lashing_flames_12:1.96%
  • lashing_flames_13:1.84%
  • lashing_flames_14:1.86%
  • lashing_flames_15:1.70%
  • lashing_flames_16:1.68%
  • lashing_flames_17:1.63%
  • lashing_flames_18:1.54%
  • lashing_flames_19:1.55%
  • lashing_flames_20:1.46%
  • lashing_flames_21:1.41%
  • lashing_flames_22:1.35%
  • lashing_flames_23:1.31%
  • lashing_flames_24:1.31%
  • lashing_flames_25:1.23%
  • lashing_flames_26:1.21%
  • lashing_flames_27:1.17%
  • lashing_flames_28:1.12%
  • lashing_flames_29:1.09%
  • lashing_flames_30:1.06%
  • lashing_flames_31:1.02%
  • lashing_flames_32:0.97%
  • lashing_flames_33:0.95%
  • lashing_flames_34:0.94%
  • lashing_flames_35:0.89%
  • lashing_flames_36:0.87%
  • lashing_flames_37:0.83%
  • lashing_flames_38:0.79%
  • lashing_flames_39:0.75%
  • lashing_flames_40:0.75%
  • lashing_flames_41:0.72%
  • lashing_flames_42:0.68%
  • lashing_flames_43:0.67%
  • lashing_flames_44:0.65%
  • lashing_flames_45:0.64%
  • lashing_flames_46:0.60%
  • lashing_flames_47:0.58%
  • lashing_flames_48:0.57%
  • lashing_flames_49:0.55%
  • lashing_flames_50:0.53%
  • lashing_flames_51:0.52%
  • lashing_flames_52:0.51%
  • lashing_flames_53:0.49%
  • lashing_flames_54:0.46%
  • lashing_flames_55:0.46%
  • lashing_flames_56:0.43%
  • lashing_flames_57:0.43%
  • lashing_flames_58:0.41%
  • lashing_flames_59:0.40%
  • lashing_flames_60:0.38%
  • lashing_flames_61:0.36%
  • lashing_flames_62:0.36%
  • lashing_flames_63:0.35%
  • lashing_flames_64:0.33%
  • lashing_flames_65:0.33%
  • lashing_flames_66:0.33%
  • lashing_flames_67:0.30%
  • lashing_flames_68:0.30%
  • lashing_flames_69:0.29%
  • lashing_flames_70:0.28%
  • lashing_flames_71:0.27%
  • lashing_flames_72:0.27%
  • lashing_flames_73:0.25%
  • lashing_flames_74:0.24%
  • lashing_flames_75:0.23%
  • lashing_flames_76:0.24%
  • lashing_flames_77:0.22%
  • lashing_flames_78:0.21%
  • lashing_flames_79:0.21%
  • lashing_flames_80:0.20%
  • lashing_flames_81:0.19%
  • lashing_flames_82:0.20%
  • lashing_flames_83:0.19%
  • lashing_flames_84:0.17%
  • lashing_flames_85:0.18%
  • lashing_flames_86:0.16%
  • lashing_flames_87:0.17%
  • lashing_flames_88:0.16%
  • lashing_flames_89:0.16%
  • lashing_flames_90:0.15%
  • lashing_flames_91:0.14%
  • lashing_flames_92:0.14%
  • lashing_flames_93:0.14%
  • lashing_flames_94:0.13%
  • lashing_flames_95:0.12%
  • lashing_flames_96:0.12%
  • lashing_flames_97:0.13%
  • lashing_flames_98:0.12%
  • lashing_flames_99:3.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:240842
  • name:Lashing Flames
  • tooltip:Damage taken from the Shaman's next Lava Lash increased by $w1%.
  • description:{$@spelldesc238142=Your Flametongue damage causes the target to take $240842s1% increased damage from your next Lava Lash. This effect stacks.}
  • max_stacks:99
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:100.00%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 1324616.81
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Deaths

death count 50624
death count pct 2024.96
avg death time 300.76
min death time 197.55
max death time 426.52
dmg taken 398217192.02

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 17481
Mean 300.34
Minimum 197.55
Maximum 426.52
Spread ( max - min ) 228.97
Range [ ( max - min ) / 2 * 100% ] 38.12%
Standard Deviation 42.1189
5th Percentile 235.60
95th Percentile 369.65
( 95th Percentile - 5th Percentile ) 134.04
Mean Distribution
Standard Deviation 0.3186
95.00% Confidence Intervall ( 299.71 - 300.96 )
Normalized 95.00% Confidence Intervall ( 99.79% - 100.21% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 756
0.1% Error 75549
0.1 Scale Factor Error with Delta=300 16
0.05 Scale Factor Error with Delta=300 61
0.01 Scale Factor Error with Delta=300 1515
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 17481
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 17481
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 17481
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 17481
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 17481
Mean 1332035.36
Minimum 1084547.79
Maximum 1687083.56
Spread ( max - min ) 602535.77
Range [ ( max - min ) / 2 * 100% ] 22.62%
Standard Deviation 81765.6337
5th Percentile 1205626.95
95th Percentile 1473814.16
( 95th Percentile - 5th Percentile ) 268187.22
Mean Distribution
Standard Deviation 618.4259
95.00% Confidence Intervall ( 1330823.27 - 1333247.45 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 145
0.1% Error 14475
0.1 Scale Factor Error with Delta=300 57072288
0.05 Scale Factor Error with Delta=300 228289152
0.01 Scale Factor Error with Delta=300 5707228793
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 17481
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 17481
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 17481
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 17481
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 313527941 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 3474
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
spec=unknown
level=113
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Max Spike Damage Frequency

This is roughly how many spikes as large as MSD Mean you take per iteration. Calculated from TMI and MSD values.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.